DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and CG33543

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:349 Identity:75/349 - (21%)
Similarity:118/349 - (33%) Gaps:99/349 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NVTYPAGREAILACSVRNLGKN-KVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISK 110
            ::|:......|:.|  :.:.|: ...|.....||....:|||........::       .|....
  Fly    56 SITHFVNESFIIFC--QTVQKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLL-------ALVFEH 111

  Fly   111 LRESDRGCYMCQINTSPMKKQVGCIDVQVPPD-------IINEESSAD-----LAVQEGEDATLT 163
            :...|||.:.|::|.:    :.|..:|.|..:       ::|::.|..     .:|:||.||.:.
  Fly   112 IALEDRGNWTCEVNGN----RNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVN 172

  Fly   164 CKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYN--GSSLRLLRLERRQMGAYLCIASNDV 226
            |...|.|.|.|:| ..:||.|        ..:....:|  .:.|.:..:.:...|.|.|.|....
  Fly   173 CFVEGMPAPEVSW-LYNGEYI--------NTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRIT 228

  Fly   227 PP-------AVSKRV----------SLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSY 274
            |.       .:..|:          :|.||:|            .:|..|.|.|.....|.|...
  Fly   229 PTFSDSDQITILLRIQHKPHWFFNETLPVQYA------------YVGGAVNLSCDAMGEPPPSFT 281

  Fly   275 WLKGARTSNGF-ASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYH 338
            ||...:...|| ..:..|.                ||.|           |.::..:.|..|.|.
  Fly   282 WLHNNKGIVGFNHRIFVAD----------------YGAT-----------LQLQMKNASQFGDYK 319

  Fly   339 CVSTNSLGRAEGTLRLYEIKLHPG 362
            |...|.||..|..     |||.||
  Fly   320 CKVANPLGMLERV-----IKLRPG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 16/82 (20%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 104..108 CDD:409353 1/3 (33%)
Ig strand F 118..123 CDD:409353 1/4 (25%)
Ig 141..238 CDD:472250 25/127 (20%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 23/108 (21%)
Ig strand B 259..263 CDD:409358 2/3 (67%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 11/58 (19%)
Ig strand E 105..109 CDD:409353 1/10 (10%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 22/94 (23%)
Ig strand B 169..173 CDD:409353 1/3 (33%)
Ig strand C 182..186 CDD:409353 2/4 (50%)
Ig strand E 205..209 CDD:409353 1/3 (33%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 28/123 (23%)
Ig strand B 266..270 CDD:409353 2/3 (67%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Ig strand E 302..309 CDD:409353 3/17 (18%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.