DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and CG33543

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:349 Identity:75/349 - (21%)
Similarity:118/349 - (33%) Gaps:99/349 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NVTYPAGREAILACSVRNLGKN-KVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISK 110
            ::|:......|:.|  :.:.|: ...|.....||....:|||........::       .|....
  Fly    56 SITHFVNESFIIFC--QTVQKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLL-------ALVFEH 111

  Fly   111 LRESDRGCYMCQINTSPMKKQVGCIDVQVPPD-------IINEESSAD-----LAVQEGEDATLT 163
            :...|||.:.|::|.:    :.|..:|.|..:       ::|::.|..     .:|:||.||.:.
  Fly   112 IALEDRGNWTCEVNGN----RNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVN 172

  Fly   164 CKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYN--GSSLRLLRLERRQMGAYLCIASNDV 226
            |...|.|.|.|:| ..:||.|        ..:....:|  .:.|.:..:.:...|.|.|.|....
  Fly   173 CFVEGMPAPEVSW-LYNGEYI--------NTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRIT 228

  Fly   227 PP-------AVSKRV----------SLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSY 274
            |.       .:..|:          :|.||:|            .:|..|.|.|.....|.|...
  Fly   229 PTFSDSDQITILLRIQHKPHWFFNETLPVQYA------------YVGGAVNLSCDAMGEPPPSFT 281

  Fly   275 WLKGARTSNGF-ASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYH 338
            ||...:...|| ..:..|.                ||.|           |.::..:.|..|.|.
  Fly   282 WLHNNKGIVGFNHRIFVAD----------------YGAT-----------LQLQMKNASQFGDYK 319

  Fly   339 CVSTNSLGRAEGTLRLYEIKLHPG 362
            |...|.||..|..     |||.||
  Fly   320 CKVANPLGMLERV-----IKLRPG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 18/92 (20%)
Ig 47..129 CDD:299845 16/82 (20%)
Ig 140..238 CDD:299845 25/128 (20%)
IG_like 247..355 CDD:214653 23/108 (21%)
Ig 256..351 CDD:299845 23/95 (24%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 18/67 (27%)
IG_like 256..336 CDD:214653 28/123 (23%)
IGc2 263..327 CDD:197706 20/90 (22%)
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.