DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and DIP-beta

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:426 Identity:167/426 - (39%)
Similarity:232/426 - (54%) Gaps:73/426 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DPEFIGFINNVTYPAGREAILACSVRNLGKN-----------KVGWLRASDQTVLALQGRVVTHN 91
            :|:|:..:.|||...||:|...|.|.|||.:           ||.|::|..:.:||:...|:|:|
  Fly    97 EPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNN 161

  Fly    92 ARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLAVQE 156
            .|:||.|.|.:||.|.|..::..|.|.||||:||.|||.|...::|.:||||||||:|.|:.|.|
  Fly   162 DRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPE 226

  Fly   157 GEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCI 221
            |..|.|.|:|.|:|:|::|||||||..|:.|. ||.:..|.:|..|..|.|.::.|.:||||:||
  Fly   227 GGSAKLVCRARGHPKPKITWRREDGREIIARN-GSHQKTKAQSVEGEMLTLSKITRSEMGAYMCI 290

  Fly   222 ASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFA 286
            |||.|||.||||:.|.|.|.|:|:.|:||:|.|:.:||.|.|.|||||..::||.:         
  Fly   291 ASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYWQR--------- 346

  Fly   287 SVSTASLESGSPGPEMLLDGPKYGITERRDG-YRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEG 350
                   |:|    ||::.|.:|.:||:.:. |...|:|.::....||.|.|.|:|.||:|..||
  Fly   347 -------ENG----EMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEG 400

  Fly   351 TLRLYEIKLHPGASASNDDHLNYIG---------GLEEAARN----------------------A 384
            |:||||:: .||.....||.||.:.         ..|:.:||                      .
  Fly   401 TIRLYEME-RPGKKILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDRAPDQHPASGSDQLL 464

  Fly   385 GRSN-RTTWQPLLAMLMLLW-------MRLSLRTGG 412
            ||.. |.....|||:|:|..       ..||.||.|
  Fly   465 GRGTMRLIGTFLLALLVLFTALAEAGPTTLSCRTKG 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 38/92 (41%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 2/3 (67%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 3/4 (75%)
Ig 141..238 CDD:472250 53/96 (55%)
Ig strand B 160..164 CDD:409562 2/3 (67%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 3/4 (75%)
Ig strand G 231..234 CDD:409562 2/2 (100%)
IG_like 247..355 CDD:214653 40/108 (37%)
Ig strand B 259..263 CDD:409358 2/3 (67%)
Ig strand C 272..276 CDD:409358 1/3 (33%)
Ig strand E 317..326 CDD:409358 3/9 (33%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 44/110 (40%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 2/3 (67%)
Ig strand E 174..178 CDD:409353 2/3 (67%)
Ig strand F 188..193 CDD:409353 3/4 (75%)
Ig strand G 202..205 CDD:409353 0/2 (0%)
Ig 211..307 CDD:472250 53/96 (55%)
Ig strand B 230..234 CDD:409353 2/3 (67%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 3/4 (75%)
Ig strand G 300..303 CDD:409353 2/2 (100%)
IG_like 327..405 CDD:214653 35/97 (36%)
Ig strand B 328..332 CDD:409353 2/3 (67%)
Ig strand C 341..346 CDD:409353 2/4 (50%)
Ig strand E 365..376 CDD:409353 3/10 (30%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 2/2 (100%)

Return to query results.
Submit another query.