DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and CG6867

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster


Alignment Length:278 Identity:81/278 - (29%)
Similarity:119/278 - (42%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 MHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPP---DIINEESSADLAVQEGEDATL 162
            ::.|||:......|:                    |:.:||   ||...:....:.|:||....|
  Fly   411 INAWKLQYPNGSSSN--------------------DLLIPPSITDIQVPDFQRTVIVEEGRSLNL 455

  Fly   163 TCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVP 227
            :|.|||.|.|:|.||||||..|.:..      :::.|.:|..||...:.|.||.||.|.|:|.:.
  Fly   456 SCTATGTPTPQVEWRREDGRTINVNG------VEMASISGQFLRFTNITRHQMAAYTCFANNGIA 514

  Fly   228 PAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTAS 292
            |..:....:.||||||:....|::.....|...|||.|||.|..:.||   .|..:|        
  Fly   515 PVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEAIRYW---ERAYDG-------- 568

  Fly   293 LESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEI 357
                    ::|....||||....:|::..|.|.:.:....|.|.||||:.|.|   ..|:..:||
  Fly   569 --------KILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNEL---NATMVNFEI 622

  Fly   358 KLHPGASASNDDHLNYIG 375
                 |....:....|:|
  Fly   623 -----APQDPNSETPYVG 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 5/37 (14%)
Ig 47..129 CDD:299845 4/27 (15%)
Ig 140..238 CDD:299845 35/100 (35%)
IG_like 247..355 CDD:214653 30/107 (28%)
Ig 256..351 CDD:299845 28/94 (30%)
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 31/88 (35%)
IGc2 449..511 CDD:197706 28/67 (42%)
IG_like 544..612 CDD:214653 26/86 (30%)
Ig 546..612 CDD:143165 25/84 (30%)
OLF 694..937 CDD:280371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11661
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.