DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and CG6867

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster


Alignment Length:278 Identity:81/278 - (29%)
Similarity:119/278 - (42%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 MHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPP---DIINEESSADLAVQEGEDATL 162
            ::.|||:......|:                    |:.:||   ||...:....:.|:||....|
  Fly   411 INAWKLQYPNGSSSN--------------------DLLIPPSITDIQVPDFQRTVIVEEGRSLNL 455

  Fly   163 TCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVP 227
            :|.|||.|.|:|.||||||..|.:..      :::.|.:|..||...:.|.||.||.|.|:|.:.
  Fly   456 SCTATGTPTPQVEWRREDGRTINVNG------VEMASISGQFLRFTNITRHQMAAYTCFANNGIA 514

  Fly   228 PAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTAS 292
            |..:....:.||||||:....|::.....|...|||.|||.|..:.||   .|..:|        
  Fly   515 PVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFPEAIRYW---ERAYDG-------- 568

  Fly   293 LESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEI 357
                    ::|....||||....:|::..|.|.:.:....|.|.||||:.|.|   ..|:..:||
  Fly   569 --------KILDPSDKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNEL---NATMVNFEI 622

  Fly   358 KLHPGASASNDDHLNYIG 375
                 |....:....|:|
  Fly   623 -----APQDPNSETPYVG 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 4/27 (15%)
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 104..108 CDD:409353 3/3 (100%)
Ig strand F 118..123 CDD:409353 0/4 (0%)
Ig 141..238 CDD:472250 34/99 (34%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 3/4 (75%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 30/107 (28%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 1/3 (33%)
Ig strand E 317..326 CDD:409358 3/8 (38%)
Ig strand F 336..341 CDD:409358 3/4 (75%)
CG6867NP_573262.2 gly_rich_SclB <257..>409 CDD:468478
Ig 436..525 CDD:472250 32/94 (34%)
Ig strand B 453..457 CDD:409353 1/3 (33%)
Ig strand C 466..470 CDD:409353 1/3 (33%)
Ig strand E 490..494 CDD:409353 1/3 (33%)
Ig strand F 504..509 CDD:409353 3/4 (75%)
Ig strand G 518..521 CDD:409353 0/2 (0%)
Ig_3 529..611 CDD:464046 29/100 (29%)
OLF 694..939 CDD:460482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.