DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr18

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:346 Identity:81/346 - (23%)
Similarity:134/346 - (38%) Gaps:68/346 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HHESSSQLDPDPEFIGFINNVTYPAG----------REAILACSVRNLGKNKVGWLRASDQTVLA 82
            |||...    .|.|...||:.|  :|          .||:|.|.|..|....|.|:|.:.:.|..
  Fly   210 HHEHHW----GPFFEEPINSAT--SGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSL 268

  Fly    83 LQGRVVTHNA--RISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIIN 145
            |....||::.  ||.|..|..:.|:|.|:..:..|.|.||||::|.|.:.....:.|..||..|.
  Fly   269 LTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRII 333

  Fly   146 EESSADLA---VQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRL 207
            :|...|:.   .:.|....|.|:.:     |..:::|...::......:..:.|:.:...|.|.|
  Fly   334 DEHERDVGDRYYKSGSTVDLQCQIS-----RSFFQKERQTILKSTDSANDAVQKLINETTSELNL 393

  Fly   208 LRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPV 272
            :....:....:   :..|:....:|.::.:....|:....::.|..   |||             
  Fly   394 IGNVNQTQHKF---SGQDLEKYFTKFITWAKDEEPLQGMTNRRLSV---SDV------------- 439

  Fly   273 SYWLKGARTSNGFASVSTASLESGSPG-------PEMLLDGP-----KYGITERRDGYRGVML-- 323
              ||. :|.|.|.|.:|.:...|.|.|       ...:|.|.     ::.|..|.:.|...||  
  Fly   440 --WLT-SRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAVQHNIGSRTEIYSLAMLGH 501

  Fly   324 LVVRSFSPSDVGTYHCVSTNS 344
            |:|..|      .:.|:.|.:
  Fly   502 LLVLIF------LFTCLKTEN 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 30/93 (32%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 3/4 (75%)
Ig 141..238 CDD:472250 15/99 (15%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 0/4 (0%)
Ig strand G 231..234 CDD:409562 1/2 (50%)
IG_like 247..355 CDD:214653 26/112 (23%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 4/10 (40%)
Ig strand F 336..341 CDD:409358 1/4 (25%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 27/82 (33%)
Ig strand B 242..246 CDD:409433 2/3 (67%)
Ig strand C 255..264 CDD:409433 3/8 (38%)
Ig strand E 292..296 CDD:409433 2/3 (67%)
Ig strand F 306..311 CDD:409433 3/4 (75%)
Ig <417..474 CDD:472250 15/75 (20%)

Return to query results.
Submit another query.