DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr8

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:244 Identity:65/244 - (26%)
Similarity:94/244 - (38%) Gaps:43/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILIMATKCGSGSTQNQHHESSSQLDPDP--------EFIGFINNVTYPAGREAILACSVRNLGKN 68
            ||.:...|..|:::....:....| |.|        ..||  .|:|...|:...|.|.|:|||..
  Fly    11 ILCLLAGCTDGASKRFFTDFLQDL-PTPGTGGPTFDTTIG--TNITGLVGKTVKLTCRVKNLGNR 72

  Fly    69 KVGWLRASDQTVLALQGRVVTHNARISVMHQ-DMHTWKLKISKLRESDRGCYMCQINTSPMKKQV 132
            .|.|:|..|..:|.:.....|.:.|...||. ....|.|:|...:..|.|.|.|||:|:|.....
  Fly    73 TVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHS 137

  Fly   133 GCIDVQVP-PDIINEESSADLAVQEGEDATLTC--KATGNPQPRVTWRREDGEMILIRKPGSREL 194
            ..:::..| .|||   ...:|.:..|....|||  |....|.|.|.|..            :||:
  Fly   138 VYLNIVEPVTDII---GGPELHINRGSTINLTCIVKFAPEPPPTVIWSH------------NREI 187

  Fly   195 MKVESYNG-------------SSLRLLRLERRQMGAYLCIASNDVPPAV 230
            :..:|..|             |.|.:.:...:..|.|.|..||..|.:|
  Fly   188 INFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 29/82 (35%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 26/105 (25%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 65/244 (27%)
IG_like 247..355 CDD:214653
Ig strand B 259..263 CDD:409358
Ig strand C 272..276 CDD:409358
Ig strand E 317..326 CDD:409358
Ig strand F 336..341 CDD:409358
dpr8NP_727781.1 IG_like 51..131 CDD:214653 27/79 (34%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 109..113 CDD:409353 2/3 (67%)
Ig strand F 123..128 CDD:409353 2/4 (50%)
Ig_3 153..230 CDD:464046 19/88 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.