DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr8

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:244 Identity:65/244 - (26%)
Similarity:94/244 - (38%) Gaps:43/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ILIMATKCGSGSTQNQHHESSSQLDPDP--------EFIGFINNVTYPAGREAILACSVRNLGKN 68
            ||.:...|..|:::....:....| |.|        ..||  .|:|...|:...|.|.|:|||..
  Fly    11 ILCLLAGCTDGASKRFFTDFLQDL-PTPGTGGPTFDTTIG--TNITGLVGKTVKLTCRVKNLGNR 72

  Fly    69 KVGWLRASDQTVLALQGRVVTHNARISVMHQ-DMHTWKLKISKLRESDRGCYMCQINTSPMKKQV 132
            .|.|:|..|..:|.:.....|.:.|...||. ....|.|:|...:..|.|.|.|||:|:|.....
  Fly    73 TVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHS 137

  Fly   133 GCIDVQVP-PDIINEESSADLAVQEGEDATLTC--KATGNPQPRVTWRREDGEMILIRKPGSREL 194
            ..:::..| .|||   ...:|.:..|....|||  |....|.|.|.|..            :||:
  Fly   138 VYLNIVEPVTDII---GGPELHINRGSTINLTCIVKFAPEPPPTVIWSH------------NREI 187

  Fly   195 MKVESYNG-------------SSLRLLRLERRQMGAYLCIASNDVPPAV 230
            :..:|..|             |.|.:.:...:..|.|.|..||..|.:|
  Fly   188 INFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 29/92 (32%)
Ig 47..129 CDD:299845 29/82 (35%)
Ig 140..238 CDD:299845 27/107 (25%)
IG_like 247..355 CDD:214653
Ig 256..351 CDD:299845
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 27/79 (34%)
V-set 52..143 CDD:284989 28/90 (31%)
IG_like 153..238 CDD:214653 23/96 (24%)
ig 153..232 CDD:278476 21/90 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12439
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.