DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Negr1

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_036019026.1 Gene:Negr1 / 320840 MGIID:2444846 Length:362 Species:Mus musculus


Alignment Length:324 Identity:90/324 - (27%)
Similarity:140/324 - (43%) Gaps:49/324 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 INNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKIS 109
            ::|:....|..|:|.|.:.: |.:|..||..|  :::...|...:.:.|:|:...:...:.|:|.
Mouse    39 VDNMLVRKGDTAVLRCYLED-GASKGAWLNRS--SIIFAGGDKWSVDPRVSISTLNKRDYSLQIQ 100

  Fly   110 KLRESDRGCYMCQINT--SPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQP 172
            .:..:|.|.|.|.:.|  :|...||. :.|||||.|.  :.|.|:.:.||.:.||||.|||.|:|
Mouse   101 NVDVTDDGPYTCSVQTQHTPRTMQVH-LTVQVPPKIY--DISNDMTINEGTNVTLTCLATGKPEP 162

  Fly   173 RVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLS 237
            .::||.        ..|.::..     .||..|.:..:.|.|.|.|.|.|.|||.....|:|.:.
Mouse   163 VISWRH--------ISPSAKPF-----ENGQYLDIYGITRDQAGEYECSAENDVSFPDVKKVRVI 214

  Fly   238 VQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKG-ARTSNGFASVSTASLESGSPGPE 301
            |.|||.::.......|| |....:.|:....|.|...|.|| .|..||...:...:..:.|    
Mouse   215 VNFAPTIQEIKSGTVTP-GRSGLIRCEGAGVPPPAFEWYKGEKRLFNGQQGIIIQNFSTRS---- 274

  Fly   302 MLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASA 365
                                 :|.|.:.:....|.|.||:.|.||....:|.|.:| :.|..|:
Mouse   275 ---------------------ILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNQI-IEPTTSS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 24/93 (26%)
Ig 47..129 CDD:299845 21/83 (25%)
Ig 140..238 CDD:299845 33/97 (34%)
IG_like 247..355 CDD:214653 23/108 (21%)
Ig 256..351 CDD:299845 20/95 (21%)
Negr1XP_036019026.1 FR1 38..55 CDD:409353 4/15 (27%)
Ig strand A' 40..46 CDD:409353 1/5 (20%)
IG_like 41..129 CDD:214653 23/91 (25%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 0/4 (0%)
FR2 61..68 CDD:409353 3/6 (50%)
Ig strand C 61..67 CDD:409353 2/5 (40%)
CDR2 69..79 CDD:409353 2/11 (18%)
Ig strand C' 71..74 CDD:409353 0/2 (0%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 8/34 (24%)
Ig strand D 84..91 CDD:409353 2/6 (33%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 3/9 (33%)
FR4 122..129 CDD:409353 2/7 (29%)
Ig strand A' 139..144 CDD:409353 2/4 (50%)
IGc2 146..204 CDD:197706 25/70 (36%)
Ig strand B 150..157 CDD:409353 4/6 (67%)
Ig strand C 163..168 CDD:409353 1/4 (25%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand E 180..186 CDD:409353 1/5 (20%)
Ig strand F 193..200 CDD:409353 3/6 (50%)
Ig_3 219..295 CDD:404760 20/101 (20%)
putative Ig strand A 219..225 CDD:409353 1/5 (20%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/28 (7%)
Ig strand F 288..293 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.