DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and CG15312

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster


Alignment Length:284 Identity:55/284 - (19%)
Similarity:88/284 - (30%) Gaps:76/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 DLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQM 215
            :.|..:|.:.::.|.|.||    :.|.:|.|....|.:            .|..|.|..:.....
  Fly    34 EYATDKGGNVSIPCIAQGN----IMWVKEHGNNSTIVQ------------TGRVLVLRNVSTTDA 82

  Fly   216 GAYLCIASNDVPPAVSKRVSLSVQ--------------------FAPMVRAPSQLLGTPLGSDVQ 260
            |.|:|.||...|...:...:.|.|                    .:|   ...||....:..:|:
  Fly    83 GIYVCFASVPRPSTTATSATTSPQNLQDKETRPLEDEDDGQGESVSP---KDDQLKEAEMEEEVE 144

  Fly   261 ------LECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYR 319
                  .:..|...|.|||.....|.|..||........:||.           |.:......||
  Fly   145 YLAHQRTKLIVRTVPGPVSQLYFKASTILGFLIWRFNKTQSGG-----------YPVRSFTAEYR 198

  Fly   320 GVMLLVVRSFS--PSDVGTYHCVSTNSLGRAEGTLRLYEI-KLHPGAS------ASNDDHLNYIG 375
            .|      |:.  |::....|..|..........:|..|: :|.|..:      |:|:     :|
  Fly   199 NV------SYKTPPANASFEHAWSRMDPINIAFNVRQMEVYRLAPNTTYEFRIWANNE-----LG 252

  Fly   376 GLEEAARNAGRSNRTTWQPLLAML 399
            ..|....|......|..:.|:.::
  Fly   253 SGEVVTTNVTTLPETKEEDLIRLI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 104..108 CDD:409353
Ig strand F 118..123 CDD:409353
Ig 141..238 CDD:472250 19/86 (22%)
Ig strand B 160..164 CDD:409562 0/3 (0%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 23/115 (20%)
Ig strand B 259..263 CDD:409358 1/9 (11%)
Ig strand C 272..276 CDD:409358 2/3 (67%)
Ig strand E 317..326 CDD:409358 3/8 (38%)
Ig strand F 336..341 CDD:409358 1/4 (25%)
CG15312NP_001245603.1 Ig 39..90 CDD:472250 15/66 (23%)
Ig strand B 43..47 CDD:409358 0/3 (0%)
Ig strand C 52..56 CDD:409358 1/7 (14%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.