DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and DIP-kappa

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:430 Identity:163/430 - (37%)
Similarity:222/430 - (51%) Gaps:73/430 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ESSSQLDPD-PEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNAR 93
            :.::|.|.| |.|...|.|||...||:|::||.|.||...||.|:|...||:|::...|::.|:|
  Fly    64 QQTAQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSR 128

  Fly    94 ISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLAVQEGE 158
            ||:.:.|..:|.|.|.::.|:|||.||||:||.||:.:.|.:.|.|||.|:...:|.|:.|:||:
  Fly   129 ISLTYNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQ 193

  Fly   159 DATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIAS 223
            :.:|.|||.|.|:|.|.|||||||.:||   |...:..|:   |..|.:.::.|..|.||||:||
  Fly   194 NISLVCKARGYPEPYVMWRREDGEEMLI---GGEHVNVVD---GELLHITKVSRLHMAAYLCVAS 252

  Fly   224 NDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASV 288
            |.|||::||||.|.|||.||:..|:||.|..||.||.|||..||.|:.::||    .|..|...:
  Fly   253 NGVPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYW----TTERGDMII 313

  Fly   289 STASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLR 353
            |..|..           |.||..|....||...|.|.:|:..|:|.|||.||:.||||..:|.::
  Fly   314 SDTSRA-----------GDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIK 367

  Fly   354 LYEIKLHPGASASNDDHLN--YIG-----------------GLEE-----AARNAGRSNRTTWQP 394
            |.|:.....|..|....||  |.|                 |:||     ...|||.:......|
  Fly   368 LDEMPTPTTAIISEMSLLNRSYDGKRRHRNKFDSANALPDYGVEEWRDGAQGNNAGNNGDNNQTP 432

  Fly   395 -------------------LLAMLML--------LWMRLS 407
                               |||.:||        ::.|||
  Fly   433 VRNPPGAFHNSAGSLAQHNLLAKIMLGIKTQSFGIFKRLS 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 38/81 (47%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 2/3 (67%)
Ig strand E 104..108 CDD:409353 2/3 (67%)
Ig strand F 118..123 CDD:409353 3/4 (75%)
Ig 141..238 CDD:472250 45/96 (47%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 4/4 (100%)
Ig strand G 231..234 CDD:409562 2/2 (100%)
IG_like 247..355 CDD:214653 41/107 (38%)
Ig strand B 259..263 CDD:409358 2/3 (67%)
Ig strand C 272..276 CDD:409358 1/3 (33%)
Ig strand E 317..326 CDD:409358 4/8 (50%)
Ig strand F 336..341 CDD:409358 3/4 (75%)
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 41/91 (45%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 2/3 (67%)
Ig strand E 139..143 CDD:409353 2/3 (67%)
Ig strand F 153..158 CDD:409353 3/4 (75%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 45/96 (47%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 4/4 (100%)
Ig strand G 260..263 CDD:409301 2/2 (100%)
IG_like 282..368 CDD:214653 37/100 (37%)
Ig strand B 288..292 CDD:409353 2/3 (67%)
Ig strand C 301..305 CDD:409353 2/7 (29%)
Ig strand E 330..340 CDD:409353 4/9 (44%)
Ig strand F 350..355 CDD:409353 3/4 (75%)
Ig strand G 363..366 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.