DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Nrg

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:409 Identity:98/409 - (23%)
Similarity:160/409 - (39%) Gaps:113/409 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SSSQLDPDPEFIGFINNVT-YPAGREAILACSVRNLGKN--KVG----------WLRASD----- 77
            ::|::..|||...:.:||| ..|..:...|||..::.::  |:|          .:.||.     
  Fly   182 NNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVFRSEYKIGNKVLLDVKQMGVSASQNKHPP 246

  Fly    78 ------------------------------QTVLALQGRVVTHNARISVMHQDMHTWKLKISKLR 112
                                          |||.:..|:.:..:.||:..|   :...|.|.:..
  Fly   247 VRQYVSRRQSLALRGKRMELFCIYGGTPLPQTVWSKDGQRIQWSDRITQGH---YGKSLVIRQTN 308

  Fly   113 ESDRGCYMCQINTSPMKKQVGCI--DVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVT 175
            ..|.|.|.|.::......|...|  :|...|....|...|..|  |.|:....|:|.|.|:|:::
  Fly   309 FDDAGTYTCDVSNGVGNAQSFSIILNVNSVPYFTKEPEIATAA--EDEEVVFECRAAGVPEPKIS 371

  Fly   176 WRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQF 240
            | ..:|:.|....|..|     .:...:::|::.|.:...|.|.|.|:|.: ..|.|.|.|:||.
  Fly   372 W-IHNGKPIEQSTPNPR-----RTVTDNTIRIINLVKGDTGNYGCNATNSL-GYVYKDVYLNVQA 429

  Fly   241 AP--MVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEML 303
            .|  :..||: .:.|..|.:|.::|:|..||.|:..||   |.||                   .
  Fly   430 EPPTISEAPA-AVSTVDGRNVTIKCRVNGSPKPLVKWL---RASN-------------------W 471

  Fly   304 LDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLG--RAEGTL------------RL 354
            |.|.:|.:....|       |.::..:.||.|.|.|.:.|..|  :|:|:|            :.
  Fly   472 LTGGRYNVQANGD-------LEIQDVTFSDAGKYTCYAQNKFGEIQADGSLVVKEHTRITQEPQN 529

  Fly   355 YEIKLHPGASAS---NDDH 370
            ||:.  .|.||:   |:.|
  Fly   530 YEVA--AGQSATFRCNEAH 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 27/141 (19%)
Ig 47..129 CDD:299845 24/129 (19%)
Ig 140..238 CDD:299845 27/97 (28%)
IG_like 247..355 CDD:214653 29/121 (24%)
Ig 256..351 CDD:299845 25/96 (26%)
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845 10/31 (32%)
IG_like 141..216 CDD:214653 11/33 (33%)
ig 251..332 CDD:278476 14/83 (17%)
I-set 339..427 CDD:254352 27/96 (28%)
Ig 354..427 CDD:299845 22/79 (28%)
I-set 432..517 CDD:254352 30/114 (26%)
Ig 446..517 CDD:299845 27/99 (27%)
I-set 522..611 CDD:254352 7/27 (26%)
ig 525..609 CDD:278476 7/24 (29%)
FN3 613..707 CDD:238020
FN3 716..807 CDD:238020
fn3 817..905 CDD:278470
FN3 917..1004 CDD:238020
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.