DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr14

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:302 Identity:74/302 - (24%)
Similarity:112/302 - (37%) Gaps:71/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LQSTLFVILIMATK----CGSGST-----------------QNQHHESSSQLDPDPE-------- 40
            ::|.||.||.:...    .|||||                 :|...|.||.....||        
  Fly     1 MRSRLFWILAIIYSSLHHIGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTE 65

  Fly    41 ------FIGFIN-----NVTYPAGREAILACSVRNLGKNKVGWL--RASDQTVLALQGRVVTHNA 92
                  |..|.:     |::........|.|.|.:|....|.|:  |..|.|::.......:.::
  Fly    66 TTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDS 130

  Fly    93 RISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVP-PDIINEESSA--DLAV 154
            |.|:..::.:.|||.|....|.|.|.|.||:::.|....:..:.:.|| .:|::|..||  :...
  Fly   131 RYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYY 195

  Fly   155 QEGEDATLTCKATGNPQPR--VTWRREDGEMILIRKPGSRELMKVESYNGSSLR--------LLR 209
            :.|....|.|..:..|.|.  :|||.           |.|.|....|..|.|::        |.|
  Fly   196 KAGSTIELQCVISKIPHPSSYITWRH-----------GPRLLNYDTSRGGISVKTDMLPGRALSR 249

  Fly   210 L-----ERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRA 246
            |     .|:..|.|.|:..|::...|...|....:.|.|..|
  Fly   250 LYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHA 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 23/83 (28%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 3/3 (100%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 28/113 (25%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 1/5 (20%)
Ig strand E 203..207 CDD:409562 1/11 (9%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 74/302 (25%)
Ig strand B 259..263 CDD:409358
Ig strand C 272..276 CDD:409358
Ig strand E 317..326 CDD:409358
Ig strand F 336..341 CDD:409358
dpr14NP_572419.1 Ig 81..175 CDD:472250 23/93 (25%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 1/3 (33%)
Ig strand E 142..146 CDD:409353 3/3 (100%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 23/98 (23%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 1/5 (20%)
Ig strand E 248..252 CDD:409473 2/3 (67%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.