| Sequence 1: | NP_651649.1 | Gene: | DIP-gamma / 43417 | FlyBaseID: | FBgn0039617 | Length: | 413 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001032740.2 | Gene: | Prtg / 315806 | RGDID: | 1307157 | Length: | 1193 | Species: | Rattus norvegicus |
| Alignment Length: | 337 | Identity: | 69/337 - (20%) |
|---|---|---|---|
| Similarity: | 120/337 - (35%) | Gaps: | 73/337 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 51 PAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESD 115
Fly 116 RGCYMCQINTSPMKKQVGCIDVQVPPDIINE----------ESSADLAVQEGEDATLTCKATGNP 170
Fly 171 QPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVS 235
Fly 236 LSVQFAPMVRAPS-----QLLGTPLGSDVQLECQVEASPSPVSYWLKGART--SNGFASVSTASL 293
Fly 294 ESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIK 358
Fly 359 LHPGASASNDDH 370 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-gamma | NP_651649.1 | IG_like | 47..139 | CDD:214653 | 17/87 (20%) |
| Ig | 47..129 | CDD:299845 | 16/77 (21%) | ||
| Ig | 140..238 | CDD:299845 | 21/107 (20%) | ||
| IG_like | 247..355 | CDD:214653 | 27/114 (24%) | ||
| Ig | 256..351 | CDD:299845 | 22/96 (23%) | ||
| Prtg | NP_001032740.2 | Ig | 32..124 | CDD:416386 | |
| Ig strand A | 32..35 | CDD:409353 | |||
| Ig strand A' | 38..44 | CDD:409353 | |||
| Ig strand B | 48..58 | CDD:409353 | |||
| Ig strand C | 62..68 | CDD:409353 | |||
| Ig strand C' | 70..73 | CDD:409353 | |||
| Ig strand D | 78..83 | CDD:409353 | |||
| Ig strand E | 85..91 | CDD:409353 | |||
| Ig strand F | 103..110 | CDD:409353 | |||
| Ig strand G | 114..124 | CDD:409353 | |||
| Ig | 131..218 | CDD:416386 | 17/87 (20%) | ||
| Ig strand B | 146..150 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 159..163 | CDD:409353 | 1/5 (20%) | ||
| Ig strand E | 183..187 | CDD:409353 | 1/7 (14%) | ||
| Ig strand F | 197..202 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 211..214 | CDD:409353 | 0/2 (0%) | ||
| Ig_3 | 230..302 | CDD:404760 | 16/79 (20%) | ||
| Ig strand B | 247..251 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 260..264 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 282..286 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 296..301 | CDD:409353 | 2/4 (50%) | ||
| I-set | 322..407 | CDD:400151 | 28/115 (24%) | ||
| Ig strand C | 352..357 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 359..362 | CDD:409353 | 1/2 (50%) | ||
| Ig strand D | 367..371 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 373..378 | CDD:409353 | 2/35 (6%) | ||
| Ig strand F | 387..394 | CDD:409353 | 2/6 (33%) | ||
| Ig strand G | 398..407 | CDD:409353 | 2/8 (25%) | ||
| FN3 | 414..507 | CDD:238020 | 3/8 (38%) | ||
| FN3 | 512..605 | CDD:238020 | |||
| fn3 | 619..694 | CDD:394996 | |||
| FN3 | 721..809 | CDD:238020 | |||
| FN3 | 816..906 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 974..1018 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1078..1193 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR12231 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||