DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Igsf9b

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001363879.1 Gene:Igsf9b / 315510 RGDID:1564717 Length:1441 Species:Rattus norvegicus


Alignment Length:375 Identity:89/375 - (23%)
Similarity:140/375 - (37%) Gaps:103/375 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 STQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNK-----VGWLRASDQTVLA 82
            ||:....:.:..|..:|||      ||..||...:|.|.|.:....:     |.|.:......:.
  Rat    14 STRGLVAQVAHGLREEPEF------VTARAGEGVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIF 72

  Fly    83 LQ-------------GRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQI----------- 123
            ::             ||...|:..           .|::.::|..|:|.|.|::           
  Rat    73 IKFGYYPPHVDPEYAGRASLHDKA-----------SLRLEQVRSEDQGWYECKVLMLDQQYDTFH 126

  Fly   124 NTSPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRK 188
            |.|.:.     :.:..|| ...|.....:..:||...|:||.|.|||:|.|||.:|.   .|:..
  Rat   127 NGSWVH-----LTINAPP-TFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKEG---TLLSA 182

  Fly   189 PGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGT 253
            .|..::      :..||.:..:.|...|||.|.|.:....|| ....|.||..|.:.:|.:.:..
  Rat   183 SGKYQV------SDGSLTVTSVSREDRGAYTCRAYSIQGEAV-HTTHLLVQGPPFIVSPPENITV 240

  Fly   254 PLGSDVQLECQVEASPSPVS---YWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERR 315
            .:..|..|.|:.||.|..::   ||    :..|.:.. :...|.     ..:|:||         
  Rat   241 NISQDALLTCRAEAYPGNLTYTWYW----QDENVYFQ-NDLKLR-----VRILIDG--------- 286

  Fly   316 DGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASA 365
                   .|::....|.|.|.|.||.:|||||:            |.|||
  Rat   287 -------TLIIFRVKPEDAGKYTCVPSNSLGRS------------PSASA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 20/110 (18%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/8 (13%)
Ig strand E 104..108 CDD:409353 1/3 (33%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 29/96 (30%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 2/3 (67%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 3/4 (75%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 26/110 (24%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 1/6 (17%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
Igsf9bNP_001363879.1 Ig 41..115 CDD:409353 14/84 (17%)
Ig strand B 41..45 CDD:409353 1/3 (33%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
Ig strand E 96..100 CDD:409353 1/14 (7%)
Ig strand F 110..115 CDD:409353 2/4 (50%)
I-set 139..225 CDD:400151 29/96 (30%)
Ig strand B 157..161 CDD:409353 1/3 (33%)
Ig strand C 170..174 CDD:409353 2/3 (67%)
Ig strand E 191..195 CDD:409353 2/3 (67%)
Ig strand F 205..210 CDD:409353 3/4 (75%)
Ig strand G 218..221 CDD:409353 1/3 (33%)
Ig_3 228..307 CDD:464046 22/104 (21%)
Ig 336..410 CDD:472250
Ig strand B 342..346 CDD:409544
Ig strand C 355..360 CDD:409544
Ig strand E 380..384 CDD:409544
Ig strand F 394..399 CDD:409544
Ig strand G 407..410 CDD:409544
Ig 429..505 CDD:472250
Ig strand B 438..442 CDD:409544
Ig strand C 451..455 CDD:409544
Ig strand E 471..475 CDD:409544
Ig strand F 485..490 CDD:409544
FN3 <490..>735 CDD:442628
Ig strand G 498..501 CDD:409544
FN3 510..605 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..821
PHA03247 <898..1246 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1044
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1111..1332
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.