DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Fas2

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:351 Identity:79/351 - (22%)
Similarity:129/351 - (36%) Gaps:62/351 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHT 103
            ||.|....|:....|:.....|:.|.....::.|:|.:.|..:|...|          ...:..|
  Fly   230 PEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADR----------FQVNPQT 284

  Fly   104 WKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLAVQEG---EDATLTCK 165
            ..:.||.:.:.|.|.|.|.     .|.:.|.:|.:...:::......:|....|   ::..:||:
  Fly   285 GLVTISSVSQDDYGTYTCL-----AKNRAGVVDQKTKLNVLVRPQIYELYNVTGARTKEIAITCR 344

  Fly   166 ATGNPQPRVTWRR-----------EDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYL 219
            |.|.|.|.:|:||           :|.:..:|.:|...|   ....:..:||:...||...|.|.
  Fly   345 AKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDE---ERGESTGTLRISNAERSDDGLYQ 406

  Fly   220 CIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGS----DVQLECQVEASPSPVSYWLKGAR 280
            |||.|....|. |...::|:|||......:|  .|:.|    ...|.|.....|:....|....|
  Fly   407 CIARNKGADAY-KTGHITVEFAPDFSHMKEL--PPVFSWEQRKANLSCLAMGIPNATIEWHWNGR 468

  Fly   281 TSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSL 345
            .   ...:...:|:....||             |.|       |:|...:......|.|::||..
  Fly   469 K---IKDLYDTNLKIVGTGP-------------RSD-------LIVHPVTRQYYSGYKCIATNIH 510

  Fly   346 GRAEGTLRLYEIKLHPGASASNDDHL 371
            |.||..::|.|.::....|.:....|
  Fly   511 GTAEHDMQLKEARVPDFVSEAKPSQL 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 19/91 (21%)
Ig 47..129 CDD:299845 16/81 (20%)
Ig 140..238 CDD:299845 27/111 (24%)
IG_like 247..355 CDD:214653 22/111 (20%)
Ig 256..351 CDD:299845 20/98 (20%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 22/103 (21%)
IGc2 243..309 CDD:197706 16/80 (20%)
IG_like 330..424 CDD:214653 26/97 (27%)
IGc2 339..412 CDD:197706 22/75 (29%)
Ig 447..518 CDD:143165 19/93 (20%)
fn3 534..611 CDD:278470 1/3 (33%)
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.