DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and kirre

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster


Alignment Length:476 Identity:100/476 - (21%)
Similarity:155/476 - (32%) Gaps:149/476 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLLQSTLFVILIM----------ATKCGSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAI 57
            :||...|.::||:          |....:.|:|:.||..||...         ::.:..:|..:.
  Fly     8 RLLVLPLILVLILTLLLQPIAVHAKSKKNKSSQSSHHGDSSSSS---------SSSSSSSGSSSA 63

  Fly    58 LACSVRNLGKNKVG-------WLRASDQTVLALQGRVVTHNARI--------------------- 94
            .|.|..:..|.|.|       .:...|||  |:.|..||...|:                     
  Fly    64 AASSANDESKPKGGDNGGQHFAMEPQDQT--AVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRN 126

  Fly    95 -------SVMHQDMH-TWKLKISKLRESDRGCYMCQINTSP-----MKKQVGCIDVQVPPDIINE 146
                   |::..|.. .:.|.|..|...|...|.||:...|     ::.:...:.|.|||:....
  Fly   127 LSGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKI 191

  Fly   147 ESSADLAVQEGEDATLTCKAT-GNPQPRVTWRREDGEMI-----LIRKP--GSRELMKVESYNGS 203
            .....|...|..:..|.|.:. |.|...:||....|.::     .:::|  .||.:..     .|
  Fly   192 TQGDYLVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITA-----RS 251

  Fly   204 SLRLLRLERRQMGAYLCIASNDVPPAV-SKRVSLSVQFAPMVRAP---SQLLG--TPLGSDVQLE 262
            .|:|...:......:.|.|.|...... |.::.|.|::||.|...   ..|.|  .|.|::|.|.
  Fly   252 ILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILS 316

  Fly   263 CQVEASPSPVSY-WLKGARTSNG----------------------------------------FA 286
            ||.:|:|..:|| |........|                                        |.
  Fly   317 CQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFG 381

  Fly   287 SV-------------STASLE---SGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVG 335
            .|             :|.|:.   :|:|.||:      ..|:|..|...||...:....|....|
  Fly   382 PVFRQRPVSVEADLGATVSMRCDVAGNPEPEI------EWISENSDQVVGVAAELKLKVSSETAG 440

  Fly   336 TYHCVST----NSLGRAEGTL 352
            .|.|.:.    ..:| ||.||
  Fly   441 RYFCKAVVNGFPEIG-AEATL 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 25/132 (19%)
Ig 47..129 CDD:299845 24/122 (20%)
Ig 140..238 CDD:299845 22/106 (21%)
IG_like 247..355 CDD:214653 36/172 (21%)
Ig 256..351 CDD:299845 31/155 (20%)
kirreNP_001245505.1 Ig 87..183 CDD:299845 18/97 (19%)
IG_like 88..182 CDD:214653 18/95 (19%)
C2-set_2 189..279 CDD:285423 18/94 (19%)
Ig_2 307..379 CDD:290606 12/71 (17%)
I-set 382..462 CDD:254352 21/86 (24%)
IGc2 396..446 CDD:197706 15/55 (27%)
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.