DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and ncam1a

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_009293555.1 Gene:ncam1a / 30447 ZFINID:ZDB-GENE-990415-31 Length:1010 Species:Danio rerio


Alignment Length:394 Identity:92/394 - (23%)
Similarity:147/394 - (37%) Gaps:94/394 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KC--GSGSTQNQ-------HHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGW- 72
            ||  .||..::|       ..:.:.|..|.|:        .:..|.:|.:.|.|.:.....:.| 
Zfish    93 KCVAKSGEKESQGTIIVKIFQKLTFQYAPSPQ--------EFNEGDDADIICDVISSPPPTIIWR 149

  Fly    73 ---LRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQ---INTSPMKKQ 131
               :|...:|.:.|  :|:::|             .|:|..::::|.|.|.|:   :....:..:
Zfish   150 YKKMRIQPETDVRL--KVLSNN-------------HLQIRGIKKTDEGDYTCEGRIMARGEIDLR 199

  Fly   132 VGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMK 196
            |..:.|.|.|.|....:..:......:..||.|.|.|.|:|.|.|.|           |:.||..
Zfish   200 VIKVIVNVLPSIRTRYTELNATADINQAVTLACHADGYPEPTVKWAR-----------GNTELES 253

  Fly   197 VESY----NGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGS 257
            .|.|    :||.|.:..:.:...|.|.|||.|..... |:.|:|:|...|.:........:.|..
Zfish   254 DEKYSLNEDGSELTIKDVNKLDEGDYKCIARNKAGER-SEEVTLNVFVQPKITFLENQTASELEE 317

  Fly   258 DVQLECQVEASPSPVSYWLKGAR--TSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRG 320
            .:.|.|:....|:|...|..|.|  |.|..||.:       .|.....|||   .:..|.|.  .
Zfish   318 QITLTCEATGDPTPNIIWSFGRRVFTENEQASWT-------RPEKHKSLDG---NVVVRSDA--R 370

  Fly   321 VMLLVVRSFSPSDVGTYHCVSTNSLG--------------RAEGTLRLY-----------EIKLH 360
            |..|.::....:|.|.|.|.:.||:|              :.:|...::           |...|
Zfish   371 VSSLTLKYVQFTDAGQYLCTARNSIGQDIQSMYLEVRYAPKIQGPQAVFTWEGNPANITCEALAH 435

  Fly   361 PGAS 364
            ||||
Zfish   436 PGAS 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 18/98 (18%)
Ig 47..129 CDD:299845 16/88 (18%)
Ig 140..238 CDD:299845 29/101 (29%)
IG_like 247..355 CDD:214653 28/123 (23%)
Ig 256..351 CDD:299845 26/110 (24%)
ncam1aXP_009293555.1 Ig 20..112 CDD:299845 5/18 (28%)
I-set 21..111 CDD:254352 5/17 (29%)
IG_like 121..200 CDD:214653 18/101 (18%)
IGc2 128..189 CDD:197706 16/75 (21%)
Ig 208..301 CDD:299845 30/104 (29%)
IG_like 219..298 CDD:214653 27/90 (30%)
Ig 300..406 CDD:299845 28/117 (24%)
IG_like 308..406 CDD:214653 27/109 (25%)
ig 413..498 CDD:278476 7/27 (26%)
IG_like 415..498 CDD:214653 6/25 (24%)
fn3 505..589 CDD:278470
FN3 624..715 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.