DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Lsamp

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:333 Identity:99/333 - (29%)
Similarity:138/333 - (41%) Gaps:72/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NNVTYPAGREAILACSVRNLGKN-KVGWLRAS-------DQTVLALQGRVVTHNARISVMHQDMH 102
            :|:|...|..|||.|.|.:  || ||.||..|       |:..|         :.|:.:..:...
  Rat    56 DNITVRQGDTAILRCVVED--KNSKVAWLNRSGIIFAGHDKWSL---------DPRVELEKRHAL 109

  Fly   103 TWKLKISKLRESDRGCYMCQINT--SPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCK 165
            .:.|:|.|:...|.|.|.|.:.|  .|...||..| |||||.|.|  .|:|:.|.||.:.||.|.
  Rat   110 EYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLI-VQVPPKISN--ISSDVTVNEGSNVTLVCM 171

  Fly   166 ATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAV 230
            |.|.|:|.:|||.        ..|..||....|.|    |.:|.:.|.|.|.|.|.|:|:|..|.
  Rat   172 ANGRPEPVITWRH--------LTPLGREFEGEEEY----LEILGITREQSGKYECKAANEVSSAD 224

  Fly   231 SKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKG---ARTSNGFASVSTAS 292
            .|:|.::|.:.|.: ..|:......|....|:|:..|.|:|...|.:.   ..::||....||  
  Rat   225 VKQVKVTVNYPPTI-TESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKST-- 286

  Fly   293 LESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEI 357
                                      .|...|.|.:.:....|.|.||:.|.||....:|.|::.
  Rat   287 --------------------------EGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKR 325

  Fly   358 KL----HP 361
            .|    ||
  Rat   326 VLPTVPHP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 31/101 (31%)
Ig 47..129 CDD:299845 27/91 (30%)
Ig 140..238 CDD:299845 37/97 (38%)
IG_like 247..355 CDD:214653 23/110 (21%)
Ig 256..351 CDD:299845 21/97 (22%)
LsampXP_038944182.1 Ig 55..145 CDD:416386 30/100 (30%)
FR1 55..71 CDD:409353 6/14 (43%)
Ig strand A' 56..62 CDD:409353 2/5 (40%)
Ig strand B 64..72 CDD:409353 4/7 (57%)
CDR1 72..76 CDD:409353 1/5 (20%)
FR2 77..84 CDD:409353 4/6 (67%)
Ig strand C 77..83 CDD:409353 3/5 (60%)
CDR2 85..95 CDD:409353 2/9 (22%)
Ig strand C' 87..90 CDD:409353 0/2 (0%)
Ig strand C' 92..95 CDD:409353 1/2 (50%)
FR3 96..131 CDD:409353 9/43 (21%)
Ig strand D 100..107 CDD:409353 1/6 (17%)
Ig strand E 110..116 CDD:409353 1/5 (20%)
Ig strand F 123..131 CDD:409353 3/7 (43%)
CDR3 132..136 CDD:409353 1/3 (33%)
Ig strand G 136..145 CDD:409353 4/9 (44%)
FR4 138..145 CDD:409353 3/7 (43%)
Ig_3 148..218 CDD:404760 32/83 (39%)
Ig strand A' 155..160 CDD:409353 2/4 (50%)
Ig strand B 166..173 CDD:409353 3/6 (50%)
Ig strand C 179..184 CDD:409353 2/4 (50%)
Ig strand D 190..193 CDD:409353 2/2 (100%)
Ig strand E 197..203 CDD:409353 2/9 (22%)
Ig strand F 210..217 CDD:409353 3/6 (50%)
Ig strand G 224..232 CDD:409353 2/7 (29%)
Ig_3 235..311 CDD:404760 20/104 (19%)
Ig strand B 252..256 CDD:409353 1/3 (33%)
Ig strand C 265..269 CDD:409353 0/3 (0%)
Ig strand E 290..294 CDD:409353 1/3 (33%)
Ig strand F 304..309 CDD:409353 2/4 (50%)
Ig strand G 318..321 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.