DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and PRTG

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_776175.2 Gene:PRTG / 283659 HGNCID:26373 Length:1150 Species:Homo sapiens


Alignment Length:427 Identity:94/427 - (22%)
Similarity:137/427 - (32%) Gaps:118/427 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LDPDP--------EFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHN 91
            |.|.|        .|:....:||.......:|.|........||.||:         .|..::.|
Human    27 LSPLPGVWCFSELSFVKEPQDVTVTRKDPVVLDCQAHGEVPIKVTWLK---------NGAKMSEN 82

  Fly    92 ARISVMHQDMHTWKLKISKL-----RESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSAD 151
            .||.|:...    .|.||::     .:||.|.|.|    ..|.| .|.|..|.....::..|:.:
Human    83 KRIEVLSNG----SLYISEVEGRRGEQSDEGFYQC----LAMNK-YGAILSQKAHLALSTISAFE 138

  Fly   152 L-----AVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLE 211
            :     .|.||..|...||.:.:|...:||     |......|.:.:  ::.:.....|::..:.
Human   139 VQPISTEVHEGGVARFACKISSHPPAVITW-----EFNRTTLPMTMD--RITALPTGVLQIYDVS 196

  Fly   212 RRQMGAYLCIASNDVPPAVSKRVSLSVQFA--------PMVRAPSQLLGTPLGSDVQLECQVEAS 268
            :|..|.|.|||:.......|...||:|..|        |.:.|..|.:.|.|...|.|||....:
Human   197 QRDSGNYRCIAATVAHRRKSMEASLTVIPAKESKSFHTPTIIAGPQNITTSLHQTVVLECMATGN 261

  Fly   269 PSPVSYWLKGARTS----------NGFASVSTASLE----------------------------- 294
            |.|:..|.:....|          ||...:|...|:                             
Human   262 PKPIISWSRLDHKSIDVFNTRVLGNGNLMISDVRLQHAGVYVCRATTPGTRNFTVAMATLTVLAP 326

  Fly   295 ------------------------SGSPGPEM--LLDGPKYGITERRDGYRGVMLLVVRSFSPSD 333
                                    .|.|.|:|  |.:|.|.....|...|..  .||:....|.|
Human   327 PSFVEWPESLTRPRAGTARFVCQAEGIPSPKMSWLKNGRKIHSNGRIKMYNS--KLVINQIIPED 389

  Fly   334 VGTYHCVSTNSLGRAEGTLRLYEIKLHPGASASNDDH 370
            ...|.|::.||.|......||..:......||..:.|
Human   390 DAIYQCMAENSQGSILSRARLTVVMSEDRPSAPYNVH 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 25/96 (26%)
Ig 47..129 CDD:299845 21/86 (24%)
Ig 140..238 CDD:299845 22/102 (22%)
IG_like 247..355 CDD:214653 34/172 (20%)
Ig 256..351 CDD:299845 30/159 (19%)
PRTGNP_776175.2 Ig 40..130 CDD:299845 27/107 (25%)
Ig 139..223 CDD:299845 21/90 (23%)
IG_like 141..223 CDD:214653 21/88 (24%)
IG_like 241..323 CDD:214653 15/81 (19%)
IGc2 250..309 CDD:197706 12/58 (21%)
I-set 327..412 CDD:254352 20/86 (23%)
Ig 345..412 CDD:299845 20/68 (29%)
FN3 419..512 CDD:238020 3/8 (38%)
FN3 517..610 CDD:238020
fn3 624..699 CDD:278470
FN3 726..814 CDD:238020
FN3 821..911 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 981..1002
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1086..1150
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.