DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and dpr9

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:341 Identity:84/341 - (24%)
Similarity:128/341 - (37%) Gaps:80/341 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ATKCGSGSTQNQ----HHESSSQLD----PDPEF-IGFINNVTYPAGREAILACSVRNLGKN--- 68
            |:...|.:..:|    .|.:|..|:    ..|.| ..|..|||...|:.|.|.|.|:|||..   
  Fly   225 ASSASSNTFSSQLASGFHRNSIDLEEARNAGPYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTML 289

  Fly    69 -KVGWLRASDQTVLALQGRVVTHNARISVMHQ-DMHTWKLKISKLRESDRGCYMCQINTSP-MKK 130
             :|.|:|..|..:|.:.....|.:.|...:|| ....|.|:|...:..|.|.|.||::|:| |..
  Fly   290 LQVSWVRHRDIHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSH 354

  Fly   131 QVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQP--RVTWRREDGEMILIRKPGSRE 193
            .:....|:...:||   .:.||.::.|....|||....:|:|  .:.|...:.      .|...:
  Fly   355 YIHLNVVEPSTEII---GAPDLYIESGSTINLTCIIQNSPEPPAYIFWNHNNA------FPSHPQ 410

  Fly   194 LMKVESYNG------------SSLRLLRLER-RQMGAYLCIASNDVPPA--------VSKRVSLS 237
            ::..:|..|            :|..|::..| ...|.|.|..||..|.:        ||..||..
  Fly   411 IINYDSPRGGVSVVTNKGDTTTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNGVSHSVSRG 475

  Fly   238 VQFAPMVRAPSQLLGTPLGSDVQL-----------ECQ--------VEASPSPVSYWLKGARTSN 283
            |..:...|..|  ..:||...:.:           .|:        ..|:|.|    |:..|.:.
  Fly   476 VPSSNAARGTS--ASSPLAHSLSVCVPVCVLLQLGACRWIAALLGAALATPPP----LRSTRRAT 534

  Fly   284 GFASVSTASLESGSPG 299
            |        ...||||
  Fly   535 G--------ERPGSPG 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 32/97 (33%)
Ig 47..129 CDD:299845 30/87 (34%)
Ig 140..238 CDD:299845 27/120 (23%)
IG_like 247..355 CDD:214653 14/72 (19%)
Ig 256..351 CDD:299845 11/63 (17%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 31/97 (32%)
IG_like 263..360 CDD:214653 31/96 (32%)
IG_like 371..464 CDD:214653 21/98 (21%)
IGc2 377..456 CDD:197706 18/84 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12439
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.