DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Cd200

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_006248387.2 Gene:Cd200 / 24560 RGDID:3104 Length:310 Species:Rattus norvegicus


Alignment Length:142 Identity:35/142 - (24%)
Similarity:54/142 - (38%) Gaps:35/142 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 AILACSVRN--------------LG-KNKVGWLRASDQTVLALQGRVV--THNARISVMHQDMHT 103
            |.|.||::.              :| :|.|.:.:|        .|.|:  |:..||::....:..
  Rat    79 ASLRCSLKTTQEPLIVTWQKKKAVGPENMVTYSKA--------HGVVIQPTYRDRINITELGLLN 135

  Fly   104 WKLKISKLRESDRGCYMCQINTSPMKKQVG--CIDVQVPPDIINEESSADLAVQEGED-ATLTCK 165
            ..:........|.|||||..|.....|..|  |:.:.|.|.:       .|.....|| ..:||.
  Rat   136 TSITFWNTTLDDEGCYMCLFNMFGSGKVSGTACLTL
YVQPIV-------HLHYNYFEDHLNITCS 193

  Fly   166 ATGNPQPRVTWR 177
            ||..|.|.::|:
  Rat   194 ATARPAPAISWK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 23/101 (23%)
Ig 47..129 CDD:299845 20/89 (22%)
Ig 140..238 CDD:299845 11/39 (28%)
IG_like 247..355 CDD:214653
Ig 256..351 CDD:299845
Cd200XP_006248387.2 IgV_1_MRC-OX-2_like 64..171 CDD:409433 23/99 (23%)
Ig strand B 79..83 CDD:409433 2/3 (67%)
Ig strand C 93..97 CDD:409433 0/3 (0%)
Ig strand E 136..140 CDD:409433 0/3 (0%)
Ig strand F 150..155 CDD:409433 4/4 (100%)
Ig strand G 164..167 CDD:409433 1/2 (50%)
ig 175..261 CDD:395002 11/38 (29%)
Ig strand C 199..205 CDD:409353 1/5 (20%)
Ig strand C' 207..209 CDD:409353
Ig strand D 212..220 CDD:409353
Ig strand E 225..233 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.