DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Ntm

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001344522.1 Gene:Ntm / 235106 MGIID:2446259 Length:367 Species:Mus musculus


Alignment Length:374 Identity:102/374 - (27%)
Similarity:160/374 - (42%) Gaps:52/374 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMH 102
            |..|...::|||...|..|.|.|::.| ...:|.||..|  |:|.........:.|:.::.....
Mouse    35 DATFPKAMDNVTVRQGESATLRCTIDN-RVTRVAWLNRS--TILYAGNDKWCLDPRVVLLSNTQT 96

  Fly   103 TWKLKISKLRESDRGCYMCQINTS--PMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCK 165
            .:.::|..:...|.|.|.|.:.|.  |...:|..| |||.|.|:  |.|:|:::.||.:.:|||.
Mouse    97 QYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLI-VQVSPKIV--EISSDISINEGNNISLTCI 158

  Fly   166 ATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAV 230
            |||.|:|.||||.        ..|.:...:..:.|    |.:..:.|.|.|.|.|.|||||...|
Mouse   159 ATGRPEPTVTWRH--------ISPKAVGFVSEDEY----LEIQGITREQSGEYECSASNDVAAPV 211

  Fly   231 SKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLES 295
            .:||.::|.:.|.: :.::..|.|:|....|:|:..|.||....|.|                  
Mouse   212 VRRVKVTVNYPPYI-SEAKGTGVPVGQKGTLQCEASAVPSAEFQWFK------------------ 257

  Fly   296 GSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLH 360
               ..:.|::|.|....|.|.   .:..|...:.|..|.|.|.||::|.||....::.|:|:...
Mouse   258 ---DDKRLVEGKKGVKVENRP---FLSKLTFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEP 316

  Fly   361 PGASASNDDHLNYI------GGLEEAARNAGRSNRTTW-QPLLAMLMLL 402
            ..::...:.....:      |.:.|......|.....| .|||.:.:||
Mouse   317 TSSTLLQEVKTTALTPWKGPGAVSEVNNGTSRRAGCIWLLPLLVLHLLL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 22/83 (27%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 0/3 (0%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 35/96 (36%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 2/3 (67%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 25/107 (23%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
NtmNP_001344522.1 Ig 44..132 CDD:472250 24/91 (26%)
Ig strand B 53..57 CDD:409353 2/3 (67%)
Ig strand C 65..69 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 136..205 CDD:464046 28/82 (34%)
Ig 223..307 CDD:472250 26/108 (24%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.