DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Ntm

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001344522.1 Gene:Ntm / 235106 MGIID:2446259 Length:367 Species:Mus musculus


Alignment Length:374 Identity:102/374 - (27%)
Similarity:160/374 - (42%) Gaps:52/374 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMH 102
            |..|...::|||...|..|.|.|::.| ...:|.||..|  |:|.........:.|:.::.....
Mouse    35 DATFPKAMDNVTVRQGESATLRCTIDN-RVTRVAWLNRS--TILYAGNDKWCLDPRVVLLSNTQT 96

  Fly   103 TWKLKISKLRESDRGCYMCQINTS--PMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCK 165
            .:.::|..:...|.|.|.|.:.|.  |...:|..| |||.|.|:  |.|:|:::.||.:.:|||.
Mouse    97 QYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLI-VQVSPKIV--EISSDISINEGNNISLTCI 158

  Fly   166 ATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAV 230
            |||.|:|.||||.        ..|.:...:..:.|    |.:..:.|.|.|.|.|.|||||...|
Mouse   159 ATGRPEPTVTWRH--------ISPKAVGFVSEDEY----LEIQGITREQSGEYECSASNDVAAPV 211

  Fly   231 SKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLES 295
            .:||.::|.:.|.: :.::..|.|:|....|:|:..|.||....|.|                  
Mouse   212 VRRVKVTVNYPPYI-SEAKGTGVPVGQKGTLQCEASAVPSAEFQWFK------------------ 257

  Fly   296 GSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLH 360
               ..:.|::|.|....|.|.   .:..|...:.|..|.|.|.||::|.||....::.|:|:...
Mouse   258 ---DDKRLVEGKKGVKVENRP---FLSKLTFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEP 316

  Fly   361 PGASASNDDHLNYI------GGLEEAARNAGRSNRTTW-QPLLAMLMLL 402
            ..::...:.....:      |.:.|......|.....| .|||.:.:||
Mouse   317 TSSTLLQEVKTTALTPWKGPGAVSEVNNGTSRRAGCIWLLPLLVLHLLL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 25/93 (27%)
Ig 47..129 CDD:299845 22/83 (27%)
Ig 140..238 CDD:299845 35/97 (36%)
IG_like 247..355 CDD:214653 25/107 (23%)
Ig 256..351 CDD:299845 23/94 (24%)
NtmNP_001344522.1 Ig 44..132 CDD:416386 24/91 (26%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 1/4 (25%)
FR2 64..70 CDD:409353 2/5 (40%)
Ig strand C 64..70 CDD:409353 2/5 (40%)
CDR2 71..83 CDD:409353 3/13 (23%)
Ig strand C' 72..76 CDD:409353 2/5 (40%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 6/33 (18%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 3/9 (33%)
FR4 125..132 CDD:409353 2/7 (29%)
Ig_3 136..205 CDD:404760 28/82 (34%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 3/8 (38%)
Ig strand F 197..205 CDD:409353 4/7 (57%)
Ig_3 222..299 CDD:404760 23/101 (23%)
putative Ig strand A 223..229 CDD:409353 1/6 (17%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.