DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Igsf9b

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:363 Identity:88/363 - (24%)
Similarity:137/363 - (37%) Gaps:103/363 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LDPDPEFIGFINNVTYPAGREAILACSVRNLGKNK-----VGWLRASDQTVLALQ---------- 84
            |..:|||      ||..||...:|.|.|.:....:     |.|.:......:.::          
Mouse    28 LREEPEF------VTARAGEGVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHVDP 86

  Fly    85 ---GRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQI-----------NTSPMKKQVGCI 135
               ||...|:..           .|::.::|..|:|.|.|::           |.|.:.     :
Mouse    87 EYAGRASLHDKA-----------SLRLEQVRSEDQGWYECKVLMLDQQYDTFHNGSWVH-----L 135

  Fly   136 DVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESY 200
            .:..|| ...|.....:..:||...|:||.|.|||:|.|||.:| |.::     |:....:|   
Mouse   136 TINAPP-TFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKE-GTLL-----GASAKYQV--- 190

  Fly   201 NGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQV 265
            :..||.:..:.|...|||.|.|.:....|| ....|.||..|.:.:|.:.:...:..|..|.|:.
Mouse   191 SDGSLTVTSVSREDRGAYTCRAYSIQGEAV-HTTHLLVQGPPFIVSPPENITVNISQDALLTCRA 254

  Fly   266 EASPSPVS---YWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVR 327
            ||.|..::   ||    :..|.:.. :...|.     ..:|:||                .|::.
Mouse   255 EAYPGNLTYTWYW----QDENVYFQ-NDLKLR-----VRILIDG----------------TLIIF 293

  Fly   328 SFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASA 365
            ...|.|.|.|.||.:|||||:            |.|||
Mouse   294 RVKPEDAGKYTCVPSNSLGRS------------PSASA 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 20/120 (17%)
Ig 47..129 CDD:299845 20/110 (18%)
Ig 140..238 CDD:299845 31/97 (32%)
IG_like 247..355 CDD:214653 26/110 (24%)
Ig 256..351 CDD:299845 25/97 (26%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273 14/84 (17%)
I-set 141..227 CDD:369462 30/96 (31%)
Ig 231..323 CDD:386229 31/127 (24%)
Ig <355..416 CDD:386229
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.