DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Igsf9b

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:363 Identity:88/363 - (24%)
Similarity:137/363 - (37%) Gaps:103/363 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LDPDPEFIGFINNVTYPAGREAILACSVRNLGKNK-----VGWLRASDQTVLALQ---------- 84
            |..:|||      ||..||...:|.|.|.:....:     |.|.:......:.::          
Mouse    28 LREEPEF------VTARAGEGVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHVDP 86

  Fly    85 ---GRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQI-----------NTSPMKKQVGCI 135
               ||...|:..           .|::.::|..|:|.|.|::           |.|.:.     :
Mouse    87 EYAGRASLHDKA-----------SLRLEQVRSEDQGWYECKVLMLDQQYDTFHNGSWVH-----L 135

  Fly   136 DVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESY 200
            .:..|| ...|.....:..:||...|:||.|.|||:|.|||.:| |.::     |:....:|   
Mouse   136 TINAPP-TFTETPPQYIEAKEGGSITMTCTAFGNPKPIVTWLKE-GTLL-----GASAKYQV--- 190

  Fly   201 NGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQV 265
            :..||.:..:.|...|||.|.|.:....|| ....|.||..|.:.:|.:.:...:..|..|.|:.
Mouse   191 SDGSLTVTSVSREDRGAYTCRAYSIQGEAV-HTTHLLVQGPPFIVSPPENITVNISQDALLTCRA 254

  Fly   266 EASPSPVS---YWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVR 327
            ||.|..::   ||    :..|.:.. :...|.     ..:|:||                .|::.
Mouse   255 EAYPGNLTYTWYW----QDENVYFQ-NDLKLR-----VRILIDG----------------TLIIF 293

  Fly   328 SFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASA 365
            ...|.|.|.|.||.:|||||:            |.|||
Mouse   294 RVKPEDAGKYTCVPSNSLGRS------------PSASA 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 20/110 (18%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/8 (13%)
Ig strand E 104..108 CDD:409353 1/3 (33%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 30/96 (31%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 2/3 (67%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 3/4 (75%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 26/110 (24%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 1/6 (17%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:409353 14/84 (17%)
Ig strand B 43..47 CDD:409353 1/3 (33%)
Ig strand C 61..65 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 1/14 (7%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
I-set 141..227 CDD:400151 30/96 (31%)
Ig strand B 159..163 CDD:409353 1/3 (33%)
Ig strand C 172..176 CDD:409353 2/3 (67%)
Ig strand E 193..197 CDD:409353 2/3 (67%)
Ig strand F 207..212 CDD:409353 3/4 (75%)
Ig strand G 220..223 CDD:409353 1/3 (33%)
Ig_3 230..309 CDD:464046 22/104 (21%)
Ig 338..412 CDD:472250
Ig strand B 344..348 CDD:409353
Ig strand C 357..362 CDD:409353
Ig strand E 382..386 CDD:409353
Ig strand F 396..401 CDD:409353
Ig strand G 409..412 CDD:409353
Ig 431..507 CDD:472250
Ig strand B 440..444 CDD:409353
Ig strand C 453..457 CDD:409353
Ig strand E 473..477 CDD:409353
Ig strand F 487..492 CDD:409353
FN3 <492..>737 CDD:442628
Ig strand G 500..503 CDD:409353
FN3 512..607 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.