DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and zig-3

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:247 Identity:56/247 - (22%)
Similarity:93/247 - (37%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPG 190
            |.:.:::....:...|.:...|...|..|..||..||.|.....|...:.|.: ||:.|    .|
 Worm    27 SNLVREIDSTHLTTKPSLKIIEGLEDNTVSTGESVTLRCDVLSTPTGVIYWEK-DGQRI----QG 86

  Fly   191 SREL---MKVESYNG---------SSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPM 243
            .:||   .||.:..|         ||.::.......:|:|.|:|:|. ...|.....:||: ...
 Worm    87 DKELNVFEKVLNAMGPTVESGIITSSYQIPCANLHHIGSYKCVATNG-HDTVESSAKISVE-GQT 149

  Fly   244 VRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPK 308
            |:..|.....|: ..:..|.:.|...:..:...:..|.:|.........::..|...|:|..|. 
 Worm   150 VKCKSTRRSAPV-ITMSTESRFELQDNAATLICRADRRANWNWMFEDKKIDFDSGRYELLPSGD- 212

  Fly   309 YGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLH 360
                           |::|....||:|:|.|::.|..|.:.|...||..|.|
 Worm   213 ---------------LLIRKIQWSDMGSYFCIAHNKYGESRGETFLYPTKKH 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 1/12 (8%)
Ig 47..129 CDD:299845 1/2 (50%)
Ig 140..238 CDD:299845 28/109 (26%)
IG_like 247..355 CDD:214653 20/107 (19%)
Ig 256..351 CDD:299845 17/94 (18%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 27/105 (26%)
Ig 61..142 CDD:143165 22/86 (26%)
IG_like 177..244 CDD:214653 16/82 (20%)
Ig <191..237 CDD:299845 13/61 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.