DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and zig-2

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:249 Identity:61/249 - (24%)
Similarity:96/249 - (38%) Gaps:58/249 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWR----REDGE------- 182
            :|.:..:|.|  |.:....:..|..|..||...|:|.|.|.|.|.:.|.    |..||       
 Worm    21 QKPIRALDSQ--PLLKFTRTPNDSNVTFGEKFVLSCGANGAPLPSIYWELNGMRIQGEETSNVYE 83

  Fly   183 -MILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRA 246
             ::...|..|...|....|     |:.....|..|||.||..|    .::|...::..|      
 Worm    84 NILNDGKQVSNAAMVSSHY-----RIPCATARNSGAYKCIIDN----GLTKLEHVAKVF------ 133

  Fly   247 PSQLLGTPLGSDVQLECQVEASPSP-----VSYWLKGARTSNGFASVS----TASLESGSPGPEM 302
                    :|.: :..|.:..:.:|     |.:.|:   .||...::|    ||:..|...|.::
 Worm   134 --------VGGN-KTNCALNDNGAPFISMTVDFRLE---ISNNAVALSCRSETATEWSWHKGEQL 186

  Fly   303 LL-DGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLY 355
            |. ||.:|.:....|       |::|:.|.||:|.|:|.:.|..|.......||
 Worm   187 LTNDGERYQMFPSGD-------LIIRNISWSDMGEYNCTARNHFGETTAITFLY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 2/9 (22%)
Ig 47..129 CDD:299845 61/249 (24%)
Ig 140..238 CDD:299845 28/109 (26%)
IG_like 247..355 CDD:214653 27/117 (23%)
Ig 256..351 CDD:299845 27/104 (26%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 28/122 (23%)
Ig 34..121 CDD:299845 25/91 (27%)
Ig <179..232 CDD:299845 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.