| Sequence 1: | NP_651649.1 | Gene: | DIP-gamma / 43417 | FlyBaseID: | FBgn0039617 | Length: | 413 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_032805.2 | Gene: | Cntn3 / 18488 | MGIID: | 99534 | Length: | 1028 | Species: | Mus musculus |
| Alignment Length: | 426 | Identity: | 91/426 - (21%) |
|---|---|---|---|
| Similarity: | 134/426 - (31%) | Gaps: | 178/426 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 46 NNVTYPAGREAILACS-VRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQD------MHT 103
Fly 104 WKLKISKLRESDRGCYMCQI-----NT----SP----------MKKQVGCIDVQVPPDIINEESS 149
Fly 150 ADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQ 214
Fly 215 MGAYLCIASN------------------------DVPPAV------------------------- 230
Fly 231 ----SKRVSL-------------------------------SVQFAPMVRAP-------SQLLGT 253
Fly 254 PLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGY 318
Fly 319 RGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRL 354 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-gamma | NP_651649.1 | IG_like | 47..139 | CDD:214653 | 25/117 (21%) |
| Ig | 47..129 | CDD:299845 | 22/107 (21%) | ||
| Ig | 140..238 | CDD:299845 | 32/181 (18%) | ||
| IG_like | 247..355 | CDD:214653 | 31/115 (27%) | ||
| Ig | 256..351 | CDD:299845 | 27/94 (29%) | ||
| Cntn3 | NP_032805.2 | Ig | 25..120 | CDD:416386 | |
| Ig strand A | 27..31 | CDD:409353 | |||
| Ig strand A' | 34..39 | CDD:409353 | |||
| Ig strand B | 45..53 | CDD:409353 | |||
| Ig strand C | 58..64 | CDD:409353 | |||
| Ig strand C' | 66..69 | CDD:409353 | |||
| Ig strand D | 76..80 | CDD:409353 | |||
| Ig strand E | 82..88 | CDD:409353 | |||
| Ig strand F | 95..104 | CDD:409353 | |||
| Ig strand G | 107..120 | CDD:409353 | |||
| Ig | 129..214 | CDD:416386 | 22/99 (22%) | ||
| Ig strand A | 130..135 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 139..145 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C | 153..159 | CDD:409353 | 1/21 (5%) | ||
| Ig strand C' | 164..166 | CDD:409353 | 1/1 (100%) | ||
| Ig strand D | 171..176 | CDD:409353 | 0/4 (0%) | ||
| Ig strand E | 179..183 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 193..201 | CDD:409353 | 2/7 (29%) | ||
| Ig strand G | 203..214 | CDD:409353 | 4/10 (40%) | ||
| Ig | 227..315 | CDD:416386 | 30/104 (29%) | ||
| Ig strand A | 227..232 | CDD:409353 | 1/4 (25%) | ||
| Ig strand A' | 235..240 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 243..252 | CDD:409353 | 2/8 (25%) | ||
| Ig strand C | 258..262 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 265..267 | CDD:409353 | 2/2 (100%) | ||
| Ig strand D | 276..279 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 280..285 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 293..301 | CDD:409353 | 5/7 (71%) | ||
| Ig strand G | 304..315 | CDD:409353 | 0/10 (0%) | ||
| Ig | 320..403 | CDD:416386 | 6/82 (7%) | ||
| Ig strand A' | 326..330 | CDD:409353 | 2/3 (67%) | ||
| Ig strand B | 334..342 | CDD:409353 | 0/7 (0%) | ||
| Ig strand C | 348..353 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 355..358 | CDD:409353 | 0/2 (0%) | ||
| Ig strand D | 363..367 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 369..374 | CDD:409353 | 0/4 (0%) | ||
| Ig strand F | 383..390 | CDD:409353 | 0/6 (0%) | ||
| Ig strand G | 394..403 | CDD:409353 | 1/8 (13%) | ||
| Ig | 408..496 | CDD:416386 | 31/115 (27%) | ||
| Ig strand A | 408..413 | CDD:409353 | 1/4 (25%) | ||
| Ig strand A' | 416..421 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 425..432 | CDD:409353 | 3/6 (50%) | ||
| Ig strand C | 440..444 | CDD:409353 | 1/3 (33%) | ||
| Ig strand D | 458..461 | CDD:409353 | 1/2 (50%) | ||
| Ig strand E | 462..467 | CDD:409353 | 2/20 (10%) | ||
| Ig strand F | 475..483 | CDD:409353 | 4/7 (57%) | ||
| Ig strand G | 489..496 | CDD:409353 | 3/6 (50%) | ||
| Ig | 498..598 | CDD:416386 | |||
| Ig strand A | 498..504 | CDD:409353 | |||
| Ig strand A' | 507..512 | CDD:409353 | |||
| Ig strand B | 515..523 | CDD:409353 | |||
| Ig strand C | 532..536 | CDD:409353 | |||
| Ig strand E | 560..564 | CDD:409353 | |||
| Ig strand F | 573..580 | CDD:409353 | |||
| Ig strand G | 587..591 | CDD:409353 | |||
| FN3 | 598..695 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 684..714 | ||||
| FN3 | 703..795 | CDD:238020 | |||
| FN3 | 805..898 | CDD:238020 | |||
| FN3 | 906..991 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||