DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and zig-4

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:306 Identity:64/306 - (20%)
Similarity:106/306 - (34%) Gaps:89/306 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINEESSAD 151
            ||..||. ..||.:||:  ..::...|.|.. |:    |||.|     |.:..|.:        .
 Worm    11 VVLINAH-PPMHAEMHS--AVVTLANEIDTN-YL----TSPAK-----IKIVAPLE--------S 54

  Fly   152 LAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESY---------NGSSLRL 207
            ..:..||...|.|.....|...:.| :.:|::|    .||.||...|..         .|....:
 Worm    55 ALIPGGETYQLRCDIMSTPAATIHW-KFNGKLI----QGSNELNVEEKLLNFGKAIVDTGIVASI 114

  Fly   208 LRLE---RRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLE-----CQ 264
            |.::   ....|.|.|:..|.                      .|.:.|.  ::|::|     |:
 Worm   115 LTIQCPSAENSGTYSCVGYNG----------------------HQTIETV--AEVEIEGEASGCR 155

  Fly   265 VEASPSP-VSYWLKGARTSNGFASVSTASLESGS-------PGPEMLLDGPKYGITERRDGYRGV 321
            .....:| :.:|........|  :|:|....:..       ...|::.:..|:.:....|     
 Worm   156 SNHKSAPEIVFWTDSRFEMTG--NVATLVCRANQQVDWVWMSNDELVKNNDKFTVLSNGD----- 213

  Fly   322 MLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASASN 367
              ||:::....|:|||.|::.|..|.|.     .|..|:|.|..|:
 Worm   214 --LVIKNIVWDDMGTYTCIARNQFGEAR-----QETFLYPTAKKSS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 16/51 (31%)
Ig 47..129 CDD:299845 14/41 (34%)
Ig 140..238 CDD:299845 20/109 (18%)
IG_like 247..355 CDD:214653 23/120 (19%)
Ig 256..351 CDD:299845 21/107 (20%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 23/136 (17%)
Ig 65..144 CDD:143165 19/107 (18%)
IG_like 176..245 CDD:214653 17/82 (21%)
Ig <193..238 CDD:299845 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.