DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and Ncam1

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:366 Identity:80/366 - (21%)
Similarity:140/366 - (38%) Gaps:77/366 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGR--VVTHNARISVMHQ 99
            |.|:        .:..|.:|::.|.|.:.....:.|.......:|....|  |:::|        
Mouse   124 PTPQ--------EFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNN-------- 172

  Fly   100 DMHTWKLKISKLRESDRGCYMC--------QINTSPMKKQVGCIDVQVPPDIINEESSADLAVQE 156
                 .|:|..::::|.|.|.|        :||...::     :.|.|||.:...:|..:.....
Mouse   173 -----YLQIRGIKKTDEGTYRCEGRILARGEINFKDIQ-----VIVNVPPTVQARQSIVNATANL 227

  Fly   157 GEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCI 221
            |:..||.|.|.|.|:|.::|.: |||.|...:....:  .:.|.:.|.|.:..:::.....|:||
Mouse   228 GQSVTLVCDADGFPEPTMSWTK-DGEPIENEEEDDEK--HIFSDDSSELTIRNVDKNDEAEYVCI 289

  Fly   222 ASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFA 286
            |.|..... ...:.|.|...|.:..........|...|.|.|:....|.|...|    |||.  .
Mouse   290 AENKAGEQ-DASIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITW----RTST--R 347

  Fly   287 SVSTASLESGS-PGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLG---- 346
            ::|:....|.: |..:..|||.....:..|     |..|.::|...:|.|.|.|.::|::|    
Mouse   348 NISSEEKASWTRPEKQETLDGHMVVRSHAR-----VSSLTLKSIQYTDAGEYICTASNTIGQDSQ 407

  Fly   347 ----------RAEGTLRLY-----------EIKLHPGASAS 366
                      :.:|.:.:|           |:..:|.|:.|
Mouse   408 SMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATIS 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 17/91 (19%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 104..108 CDD:409353 1/3 (33%)
Ig strand F 118..123 CDD:409353 2/12 (17%)
Ig 141..238 CDD:472250 24/96 (25%)
Ig strand B 160..164 CDD:409562 2/3 (67%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 27/122 (22%)
Ig strand B 259..263 CDD:409358 2/3 (67%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 2/8 (25%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
Ncam1XP_006510118.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451
Ig strand F 92..100 CDD:409451
Ig strand G 104..115 CDD:409451
IG_like 124..190 CDD:214653 16/86 (19%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 2/16 (13%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
IgI_3_NCAM-1 211..308 CDD:143207 26/100 (26%)
Ig strand A 211..216 CDD:143207 2/4 (50%)
Ig strand A' 220..226 CDD:143207 0/5 (0%)
Ig strand B 229..239 CDD:143207 4/9 (44%)
Ig strand C 243..249 CDD:143207 2/5 (40%)
Ig strand C' 251..253 CDD:143207 1/1 (100%)
Ig strand D 263..266 CDD:143207 0/4 (0%)
Ig strand E 271..277 CDD:143207 2/5 (40%)
Ig strand F 283..292 CDD:143207 4/8 (50%)
Ig strand G 295..307 CDD:143207 2/12 (17%)
IgI_NCAM-1 307..413 CDD:143277 27/116 (23%)
Ig strand A 307..312 CDD:143277 1/4 (25%)
Ig strand A' 316..320 CDD:143277 0/3 (0%)
Ig strand B 325..333 CDD:143277 3/7 (43%)
Ig strand C 339..345 CDD:143277 2/9 (22%)
Ig strand C' 348..351 CDD:143277 0/2 (0%)
Ig strand D 369..375 CDD:143277 0/5 (0%)
Ig strand E 378..384 CDD:143277 2/5 (40%)
Ig strand F 392..400 CDD:143277 3/7 (43%)
Ig strand G 403..413 CDD:143277 1/9 (11%)
IG_like 422..500 CDD:214653 5/27 (19%)
Ig strand B 433..437 CDD:409353 0/3 (0%)
Ig strand C 446..450 CDD:409353 1/3 (33%)
Ig strand E 473..477 CDD:409353
Ig strand F 487..492 CDD:409353
fn3 512..599 CDD:394996
fn3 649..731 CDD:394996
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.