| Sequence 1: | NP_651649.1 | Gene: | DIP-gamma / 43417 | FlyBaseID: | FBgn0039617 | Length: | 413 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006510118.1 | Gene: | Ncam1 / 17967 | MGIID: | 97281 | Length: | 1162 | Species: | Mus musculus |
| Alignment Length: | 366 | Identity: | 80/366 - (21%) |
|---|---|---|---|
| Similarity: | 140/366 - (38%) | Gaps: | 77/366 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 PDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGR--VVTHNARISVMHQ 99
Fly 100 DMHTWKLKISKLRESDRGCYMC--------QINTSPMKKQVGCIDVQVPPDIINEESSADLAVQE 156
Fly 157 GEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCI 221
Fly 222 ASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFA 286
Fly 287 SVSTASLESGS-PGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLG---- 346
Fly 347 ----------RAEGTLRLY-----------EIKLHPGASAS 366 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-gamma | NP_651649.1 | Ig | 47..129 | CDD:472250 | 17/91 (19%) |
| Ig strand B | 56..60 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 69..73 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 104..108 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 118..123 | CDD:409353 | 2/12 (17%) | ||
| Ig | 141..238 | CDD:472250 | 24/96 (25%) | ||
| Ig strand B | 160..164 | CDD:409562 | 2/3 (67%) | ||
| Ig strand C | 173..177 | CDD:409562 | 0/3 (0%) | ||
| Ig strand E | 203..207 | CDD:409562 | 2/3 (67%) | ||
| Ig strand F | 217..222 | CDD:409562 | 2/4 (50%) | ||
| Ig strand G | 231..234 | CDD:409562 | 0/2 (0%) | ||
| IG_like | 247..355 | CDD:214653 | 27/122 (22%) | ||
| Ig strand B | 259..263 | CDD:409358 | 2/3 (67%) | ||
| Ig strand C | 272..276 | CDD:409358 | 0/3 (0%) | ||
| Ig strand E | 317..326 | CDD:409358 | 2/8 (25%) | ||
| Ig strand F | 336..341 | CDD:409358 | 2/4 (50%) | ||
| Ncam1 | XP_006510118.1 | IgI_1_NCAM-1 | 20..116 | CDD:409451 | |
| Ig strand A | 20..25 | CDD:409451 | |||
| Ig strand A' | 28..32 | CDD:409451 | |||
| Ig strand B | 34..44 | CDD:409451 | |||
| Ig strand C | 50..56 | CDD:409451 | |||
| Ig strand C' | 59..61 | CDD:409451 | |||
| Ig strand D | 69..75 | CDD:409451 | |||
| Ig strand E | 77..85 | CDD:409451 | |||
| Ig strand F | 92..100 | CDD:409451 | |||
| Ig strand G | 104..115 | CDD:409451 | |||
| IG_like | 124..190 | CDD:214653 | 16/86 (19%) | ||
| Ig strand B | 135..139 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 148..152 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 172..176 | CDD:409353 | 2/16 (13%) | ||
| Ig strand F | 186..191 | CDD:409353 | 2/4 (50%) | ||
| IgI_3_NCAM-1 | 211..308 | CDD:143207 | 26/100 (26%) | ||
| Ig strand A | 211..216 | CDD:143207 | 2/4 (50%) | ||
| Ig strand A' | 220..226 | CDD:143207 | 0/5 (0%) | ||
| Ig strand B | 229..239 | CDD:143207 | 4/9 (44%) | ||
| Ig strand C | 243..249 | CDD:143207 | 2/5 (40%) | ||
| Ig strand C' | 251..253 | CDD:143207 | 1/1 (100%) | ||
| Ig strand D | 263..266 | CDD:143207 | 0/4 (0%) | ||
| Ig strand E | 271..277 | CDD:143207 | 2/5 (40%) | ||
| Ig strand F | 283..292 | CDD:143207 | 4/8 (50%) | ||
| Ig strand G | 295..307 | CDD:143207 | 2/12 (17%) | ||
| IgI_NCAM-1 | 307..413 | CDD:143277 | 27/116 (23%) | ||
| Ig strand A | 307..312 | CDD:143277 | 1/4 (25%) | ||
| Ig strand A' | 316..320 | CDD:143277 | 0/3 (0%) | ||
| Ig strand B | 325..333 | CDD:143277 | 3/7 (43%) | ||
| Ig strand C | 339..345 | CDD:143277 | 2/9 (22%) | ||
| Ig strand C' | 348..351 | CDD:143277 | 0/2 (0%) | ||
| Ig strand D | 369..375 | CDD:143277 | 0/5 (0%) | ||
| Ig strand E | 378..384 | CDD:143277 | 2/5 (40%) | ||
| Ig strand F | 392..400 | CDD:143277 | 3/7 (43%) | ||
| Ig strand G | 403..413 | CDD:143277 | 1/9 (11%) | ||
| IG_like | 422..500 | CDD:214653 | 5/27 (19%) | ||
| Ig strand B | 433..437 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 446..450 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 473..477 | CDD:409353 | |||
| Ig strand F | 487..492 | CDD:409353 | |||
| fn3 | 512..599 | CDD:394996 | |||
| fn3 | 649..731 | CDD:394996 | |||
| PHA03247 | <905..1140 | CDD:223021 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||