DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and lad-2

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001023496.1 Gene:lad-2 / 177078 WormBaseID:WBGene00002243 Length:1187 Species:Caenorhabditis elegans


Alignment Length:319 Identity:75/319 - (23%)
Similarity:121/319 - (37%) Gaps:73/319 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GREAILACS-VRNLGKNKVGWLRAS--DQTVL-ALQGRVVT--------------HNARISVMHQ 99
            |....|.|: .|.....|:.||..|  |.:|: .::.|.:|              .:.:.:::::
 Worm   141 GESLTLNCTPPRGTPDPKIVWLYRSLDDSSVIETIRSRHITVDNEGHLHFSSVELSDGKATLVYE 205

  Fly   100 DMHTWKLKISKLRESDR---GCYMCQINTSPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDAT 161
            ...|..:...:.|..||   .....|..:.|:||      :.|.|        :::.|:.|....
 Worm   206 CAATSPVLRGE
YRSGDRIQLDIEPSQDKSHPVKK------MSVSP--------SEVTVRAGGQLK 256

  Fly   162 LTCKATGNPQPRVTWRREDGEMILIRKPGSR--ELMKVESYNGSSLRLLRLERRQMGAYLCIASN 224
            |.|...|.|.|.:.|.:.|||:     |.||  :|...||..|.||.:..:.....|||.|...:
 Worm   257 LQCIFGGRPLPTIFWSKIDGEL-----PKSRIKDLTSHESDFGRSLIVENVHPDDAGAYECRGRH 316

  Fly   225 DVPPAVSKRVSLSVQFAPMVR-APSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASV 288
            .|     ..|::.|..||... .|.:.:..|..|..:|||.....|:|:..|....:..:..|..
 Worm   317 LV-----HTVNVRV
MAAPFWEFDPPRDISLPEESTGELECLAGGQPTPIITWSMNGKFLHELAED 376

  Fly   289 STASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPS-DVGTYHCVSTNSLG 346
            |.          .:|||..:              :|.||:.:.. |.|.|.|.::|.||
 Worm   377 SR----------RVLLDHGR--------------ILRVRNLNHDLDTGVYQCNASNPLG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 18/96 (19%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 0/3 (0%)
Ig strand F 118..123 CDD:409353 0/4 (0%)
Ig 141..238 CDD:472250 27/98 (28%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 2/3 (67%)
Ig strand F 217..222 CDD:409562 3/4 (75%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 24/101 (24%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
lad-2NP_001023496.1 Ig 25..121 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 61..65 CDD:409353
Ig strand E 87..91 CDD:409353
Ig strand F 101..106 CDD:409353
Ig strand G 115..118 CDD:409353
Ig 133..216 CDD:472250 13/74 (18%)
Ig strand B 144..148 CDD:409353 1/3 (33%)
Ig strand C 158..162 CDD:409353 1/3 (33%)
Ig strand E 186..190 CDD:409353 0/3 (0%)
Ig strand F 203..208 CDD:409353 0/4 (0%)
Ig 243..325 CDD:472250 27/99 (27%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 295..299 CDD:409353 2/3 (67%)
Ig strand F 309..314 CDD:409353 3/4 (75%)
Ig4_L1-NrCAM_like 330..422 CDD:409367 24/106 (23%)
Ig strand B 347..351 CDD:409367 1/3 (33%)
Ig strand C 360..364 CDD:409367 0/3 (0%)
Ig strand E 386..390 CDD:409367 1/17 (6%)
Ig strand F 401..406 CDD:409367 2/4 (50%)
Ig strand G 414..417 CDD:409367
IG_like 438..515 CDD:214653
Ig strand B 444..448 CDD:409353
Ig strand C 457..461 CDD:409353
Ig strand E 482..485 CDD:409353
Ig strand F 495..500 CDD:409353
Ig strand G 508..511 CDD:409353
Ig 527..593 CDD:472250
Ig strand B 538..542 CDD:409353
Ig strand C 551..557 CDD:409353
Ig strand E 574..578 CDD:409353
Ig strand F 588..593 CDD:409353
FN3 610..697 CDD:238020
FN3 <666..1095 CDD:442628
fn3 823..909 CDD:394996
FN3 921..1010 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.