DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and zig-8

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:232 Identity:58/232 - (25%)
Similarity:96/232 - (41%) Gaps:28/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 STLFVIL---IMATKCGSGSTQN----QHHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRN 64
            |.:.|||   :.||  |.|:::.    ...|.|...:|....:..:      |...|.|.|||..
 Worm     5 SNICVILFSFLYAT--GHGASEEVMACLRQERSRVENPSQTIVNVV------AENPAYLHCSVPP 61

  Fly    65 LGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMK 129
            ..::::.|.|.||..:|....|..|.:.|..|..:..:.|.|.:.:..:.|.|||:|:||.....
 Worm    62 DAEHEIAWTRVSDGALLTAGNRTFTRDPRWQVSKKSANIWVLNLRRAEQQDSGCYLCEINDKHNT 126

  Fly   130 KQVGCIDVQVP----PDIINEESSADLAVQEGEDATLTCKATGNPQPR----VTWRREDGEMILI 186
            .....:.|..|    |..:.::|:..:|...|::..|.|..|...:..    |.|.| ||..|..
 Worm   127 VYAVYLKVLEPPLPSPSSLQKKSTKLMANMSGDEVVLNCTVTSTDKDEEVLDVVWTR-DGNTINF 190

  Fly   187 RKPGSRELMKVESYNGSSLRLLRLERRQM---GAYLC 220
            ... .:.::||:...|..:..:|:.:..|   |.|.|
 Worm   191 NDT-EKYILKVKRDAGVVIETMRIRKATMEDDGNYAC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 25/91 (27%)
Ig 47..129 CDD:299845 24/81 (30%)
Ig 140..238 CDD:299845 22/92 (24%)
IG_like 247..355 CDD:214653
Ig 256..351 CDD:299845
zig-8NP_499714.1 IG_like 55..134 CDD:214653 22/78 (28%)
Ig 55..129 CDD:143165 22/73 (30%)
ig 158..229 CDD:278476 18/71 (25%)
IG_like 158..227 CDD:214653 18/71 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.