DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DIP-gamma and Cd200

DIOPT Version :9

Sequence 1:	NP_651649.1	Gene:	DIP-gamma / 43417	FlyBaseID:	FBgn0039617	Length:	413	Species:	Drosophila melanogaster
Sequence 2:	NP_034948.3	Gene:	Cd200 / 17470	MGIID:	1196990	Length:	278	Species:	Mus musculus

Alignment Length:	100	Identity:	29/100 - (28%)
Similarity:	41/100 - (41%)	Gaps:	18/100 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    89 THNARISVMHQD------MHTWKLKIS--KLRESDRGCYMCQINTSPMKKQVG--CIDVQVPPDI 143
            ||...|...::|      :..|...|:  .....|.|||||..||...:|..|  |:.:.|.|.:
Mouse    81 THGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIV 145

  Fly   144 INEESSADLAVQEGED-ATLTCKATGNPQPRVTWR 177
                   .|.....|| ..:||.||..|.|.::|:
Mouse   146 -------HLHYNYFEDHLNITCSATARPAPAISWK 173

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DIP-gamma	NP_651649.1	IG_like	47..139	CDD:214653	17/59 (29%)
		Ig	47..129	CDD:299845	14/47 (30%)
		Ig	140..238	CDD:299845	11/38 (29%)
		IG_like	247..355	CDD:214653
		Ig	256..351	CDD:299845
Cd200	NP_034948.3	Ig1_MRC-OX-2_like	44..140	CDD:143254	17/58 (29%)
Cd200	NP_034948.3	ig	143..229	CDD:278476	11/37 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910