DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and LOC1280607

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_061511998.1 Gene:LOC1280607 / 1280607 VectorBaseID:AGAMI1_008834 Length:526 Species:Anopheles gambiae


Alignment Length:331 Identity:82/331 - (24%)
Similarity:122/331 - (36%) Gaps:49/331 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 MHTW---KLKISKLRESDRGCYMCQINTSPMK-KQVGCIDVQVPPD-IINEESSADLAVQEGEDA 160
            |..|   .|::::::..|.|.|.|:|.|...| .|...|:||.... .|..|...|:.|  |:..
Mosquito    88 MRLWPNGSLEVTEVQTDDTGDYTCEIMTDGGKASQHHAIEVQFQATAAIYPEDPIDIRV--GQIL 150

  Fly   161 TLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASND 225
            ...|:.||.|||.|.|..::            |.......|...|.:|..:|...|...|.|:|.
Mosquito   151 EAVCQVTGMPQPYVKWMMQN------------ENATAPFENERKLNVLIEDRTFSGPLQCTATNG 203

  Fly   226 VPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVST 290
            |....|..|.:.|.|.|.:...|..:.|.:|....|||.|.|.|:...:|.     .:|...|..
Mosquito   204 VGEPASAAVEVIVNFVPEIEVKSPTVHTRIGETGLLECLVTAHPAASIHWF-----HHGLPVVYD 263

  Fly   291 ASLESGSPGPEMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRL- 354
            ..:..    .:.|:...:|...:|..       |.:||...:|:|.|.|.:.|.:|.|...|.| 
Mosquito   264 RRIVK----LDTLVTKHQYYTVQRHQ-------LAIRSLRDADLGQYECKAGNRVGIAGAQLELT 317

  Fly   355 ---YEIKLHPGASASNDDHLNYIGGLEEAA---------RNAGRSNRTTWQPLLAMLMLLWMRLS 407
               ......|.|..|:....|:|...|..:         |.....|.|..:..|.. ...|..|.
Mosquito   318 GRPMVASFKPAAEMSSPTRHNFIWQTESHSPLIEYKLKFRRVPSGNVTPGRRTLPQ-QFAWKELI 381

  Fly   408 LRTGGA 413
            :.:.|:
Mosquito   382 IPSDGS 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 9/30 (30%)
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 104..108 CDD:409353 2/6 (33%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 25/97 (26%)
Ig strand B 160..164 CDD:409562 0/3 (0%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 1/4 (25%)
Ig strand G 231..234 CDD:409562 1/2 (50%)
IG_like 247..355 CDD:214653 27/111 (24%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 2/4 (50%)
LOC1280607XP_061511998.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.