DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and CD226

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001290547.1 Gene:CD226 / 10666 HGNCID:16961 Length:336 Species:Homo sapiens


Alignment Length:148 Identity:33/148 - (22%)
Similarity:58/148 - (39%) Gaps:31/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NVTYPAGREAILACSVRNLG-KNKVGWLR-ASDQTVLAL----QGRVV--THNARISVMHQDM-- 101
            :.:.|......|.|...::| ..:|.|.: .:.|..:|:    .|.|:  .:..|:..::..|  
Human    24 HTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMAS 88

  Fly   102 HTWKLKISKLRESDRGCYMCQINTSPMKK--------QVGCIDVQVPPDIINEESSADLAVQEGE 158
            :...|......|.|.|.|.|.:.|.|...        |....:..||       |::.:..:.|:
Human    89 NNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVP-------SNSHIVSEPGK 146

  Fly   159 DATLTCKATGNPQPRVTW 176
            :.||||      ||::||
Human   147 NVTLTC------QPQMTW 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 21/109 (19%)
Ig 47..129 CDD:299845 20/91 (22%)
Ig 140..238 CDD:299845 11/37 (30%)
IG_like 247..355 CDD:214653
Ig 256..351 CDD:299845
CD226NP_001290547.1 Ig 31..127 CDD:299845 19/95 (20%)
Ig 136..240 CDD:299845 10/29 (34%)
IG_like 138..240 CDD:214653 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.