DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and si:dkey-31e10.5

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_003197671.2 Gene:si:dkey-31e10.5 / 100536909 ZFINID:ZDB-GENE-121214-76 Length:281 Species:Danio rerio


Alignment Length:188 Identity:45/188 - (23%)
Similarity:77/188 - (40%) Gaps:23/188 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GREAILACSVRNL-GKNKVGWLRASDQTVLALQGRVVTHNARIS-----------VMHQDMHTWK 105
            |::|.|:|::..: |..:|.|.|...|.|..|    .|.:.|..           :.....::..
Zfish    31 GQDASLSCTLPFVSGVKQVTWQRVRAQDVHTL----ATFSERFKDNVDEDFVGKIIFQASFNSTT 91

  Fly   106 LKISKLRESDRGCYMCQINTSPM--KKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATG 168
            ::|......|..||:|.....|.  |::..|:.|:...:|....:.||.:..|   ..::|.|||
Zfish    92 IEIKNTTFEDEACYICSFKLYPTGPKRETLCVTVKGISEITAAVNPADTSDTE---VVVSCSATG 153

  Fly   169 NPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYL-CIASND 225
            .|.|.:.|:..:.|:...|........|..|...:|...|.|.:.. |.|: |:|.:|
Zfish   154 KPAPTIQWKSREQELKHFRSDDFTTHNKDSSTTVTSNITLPLSQFH-GKYVECLAQSD 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 22/99 (22%)
Ig 47..129 CDD:299845 19/89 (21%)
Ig 140..238 CDD:299845 23/87 (26%)
IG_like 247..355 CDD:214653
Ig 256..351 CDD:299845
si:dkey-31e10.5XP_003197671.2 Ig1_MRC-OX-2_like 31..126 CDD:143254 21/98 (21%)
Ig 132..>205 CDD:299845 19/76 (25%)
IG_like 145..220 CDD:214653 19/67 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.