DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and cadm1

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_004916145.1 Gene:cadm1 / 100496522 XenbaseID:XB-GENE-6033349 Length:457 Species:Xenopus tropicalis


Alignment Length:383 Identity:85/383 - (22%)
Similarity:155/383 - (40%) Gaps:83/383 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVILIMATKCG------SGSTQNQHHESSSQLDP---DPEFIGFI-NNVTYPAGREAILACSVRN 64
            |::|:.....|      |.|.|:.:.......:|   ..|....: .:||...|..||::|.|:|
 Frog    11 FLLLVTGLHAGLLQQGRSSSLQSSYENIDLLYEPLQMSGEHQNLVTEDVTVVEGEVAIISCRVKN 75

  Fly    65 LGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMK 129
            ...:.:..|..:.||:.....|.: .::|..:::...:..::.:|.:...|.|.|:||:.|.|.:
 Frog    76 SDDSVIQLLNPNRQTIYFRDVRPL-KDSRFQLVNFSSNELRVSLSNVTLEDEGRYLCQVYTDPPQ 139

  Fly   130 KQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKA-TGNPQPRVTWRREDGEMILIR---KPG 190
            :....|.|.|||..:..:...|..| |||:..:.|.| ...|...:.|.:.:.|:..::   :|.
 Frog   140 EAFTTITVLVPPHNLVIDVQKDTYV-EGEEVEMNCTALASKPAAAIRWFKGNKELTAVKTDVEPM 203

  Fly   191 SRELMKVESYNGSSLRLLRLERRQMG-AYLCIASNDVPPAVSKRVSLSVQFAPM----VRAPSQL 250
            ...:.:|.|.     .:|..:|...| ..:|:..:.....:..:..|.||:.|:    |:.|..|
 Frog   204 EERMFRVRSQ-----LVLTAKREDDGIPIVCLVDHPAVKDLQTQQYLEVQYKPLVSVSVKYPQGL 263

  Fly   251 LGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLL------DGPKY 309
              |..|..::|.|..                             :|.|.||.:|      |.|::
 Frog   264 --TREGETLELVCSA-----------------------------TGKPSPERVLWQRVDDDLPEH 297

  Fly   310 GITERRDGYRGVML----LVVRSFSPSDVGTYHCVSTNSLGRAEG--TLRLYEIKLHP 361
                       |::    |:..:.:.:|.|||.|.::||:|.|..  ||.:|:   ||
 Frog   298 -----------VLILGDNLLFGNLNKTDNGTYRCEASNSVGSASADYTLFVYD---HP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 21/81 (26%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 104..108 CDD:409353 0/3 (0%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 19/101 (19%)
Ig strand B 160..164 CDD:409562 0/3 (0%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 0/3 (0%)
Ig strand F 217..222 CDD:409562 1/4 (25%)
Ig strand G 231..234 CDD:409562 0/2 (0%)
IG_like 247..355 CDD:214653 26/119 (22%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 2/12 (17%)
Ig strand F 336..341 CDD:409358 3/4 (75%)
cadm1XP_004916145.1 IgV_1_Necl-2 54..147 CDD:409465 22/93 (24%)
FR1 54..72 CDD:409465 5/17 (29%)
Ig strand A 54..56 CDD:409465 0/1 (0%)
Ig strand A' 57..63 CDD:409465 2/5 (40%)
Ig strand B 65..73 CDD:409465 3/7 (43%)
CDR1 73..78 CDD:409465 2/4 (50%)
FR2 79..86 CDD:409465 1/6 (17%)
Ig strand C 79..85 CDD:409465 0/5 (0%)
CDR2 87..98 CDD:409465 2/10 (20%)
Ig strand C' 89..93 CDD:409465 2/3 (67%)
Ig strand C' 95..98 CDD:409465 0/2 (0%)
FR3 99..134 CDD:409465 7/35 (20%)
Ig strand D 103..110 CDD:409465 1/6 (17%)
Ig strand E 113..119 CDD:409465 0/5 (0%)
Ig strand F 126..134 CDD:409465 4/7 (57%)
CDR3 135..138 CDD:409465 1/2 (50%)
Ig strand G 138..147 CDD:409465 1/8 (13%)
FR4 140..147 CDD:409465 1/6 (17%)
IgI_2_Necl-2 148..247 CDD:409466 21/104 (20%)
Ig strand A 148..151 CDD:409466 1/2 (50%)
Ig strand A' 154..158 CDD:409466 0/3 (0%)
Ig strand B 167..177 CDD:409466 3/9 (33%)
Ig strand C 180..189 CDD:409466 2/8 (25%)
Ig strand C' 190..193 CDD:409466 0/2 (0%)
Ig strand D 196..203 CDD:409466 0/6 (0%)
Ig strand E 207..217 CDD:409466 2/14 (14%)
Ig strand F 225..233 CDD:409466 1/7 (14%)
Ig strand G 239..246 CDD:409466 0/6 (0%)
Ig 267..337 CDD:472250 23/109 (21%)
Ig strand B 270..274 CDD:409353 1/3 (33%)
Ig strand C 283..288 CDD:409353 2/4 (50%)
Ig strand E 304..307 CDD:409353 1/2 (50%)
Ig strand F 317..322 CDD:409353 3/4 (75%)
Ig strand G 330..333 CDD:409353 0/2 (0%)
4.1m 410..428 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.