DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and cadm3

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_002937798.1 Gene:cadm3 / 100490204 XenbaseID:XB-GENE-1012965 Length:401 Species:Xenopus tropicalis


Alignment Length:390 Identity:93/390 - (23%)
Similarity:158/390 - (40%) Gaps:78/390 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VILIMATKCGSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKNKVGWLRA 75
            |||::.....:|:......:.|..:..|         |..|.|..|||.|:|:...::.:.|...
 Frog     5 VILLLCLSSLTGAANLPPEDPSQPVTAD---------VVVPTGGTAILKCTVQEHQESSLQWSNT 60

  Fly    76 SDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPM---KKQVGCIDV 137
            :.||:...:.|.:..| ||.::|...:...:.||.:..||.|.|.|.|.|.|:   |..|..:.|
 Frog    61 AQQTLYFGEKRALRDN-RIQLVHSSPNELTISISNVVLSDEGEYTCSIFTMPVRTAKAVVTVLGV 124

  Fly   138 QVPPDIINEESSADLAVQEGEDATLTCKATGN-PQPRVTWRREDGEMILIRKPGSRELMKVESYN 201
            ...|.:.    ..||..:|.:.|.|.|..:|: |...:.|.:...|:     .|::..: :|..|
 Frog   125 PQKPQVF----GFDLPFKENDKARLRCTTSGSKPAAIIKWYKGPEEL-----EGAKTSV-LEDGN 179

  Fly   202 GSSLRLL-----RLERRQMGAYL-CIASNDVPPAVSKRVS--LSVQFAPMVRAPSQLLGTPLGSD 258
            |.:..::     .:.:...||.: |...::.....||..|  :.||:.|..:..|:......|..
 Frog   180 GKTFTVMSFIEFTVTKDDDGAEITCAVGHESLHDSSKSSSHKIQVQYKPTAKIESRPNMPREGDK 244

  Fly   259 VQLECQVEASPSPVSY-WLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGVM 322
            ::|:|....:|.|.:| |    ...||...| .|::|..|                         
 Frog   245 LRLQCDAYGNPVPENYVW----ERENGELPV-LANIEGNS------------------------- 279

  Fly   323 LLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLH----------PGASASNDDHLNYIGGL 377
             ||..:.:.||.|||.|.::|:||.   .:..|::.::          |..|.|:.||. .|||:
 Frog   280 -LVFLTLNKSDSGTYTCTASNALGT---FITHYKLDVNDAPVSHTDPSPIPSTSSIDHA-VIGGV 339

  Fly   378  377
             Frog   340  339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 26/84 (31%)
Ig strand B 56..60 CDD:409353 3/3 (100%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 104..108 CDD:409353 0/3 (0%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 21/105 (20%)
Ig strand B 160..164 CDD:409562 2/3 (67%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 0/3 (0%)
Ig strand F 217..222 CDD:409562 2/5 (40%)
Ig strand G 231..234 CDD:409562 2/2 (100%)
IG_like 247..355 CDD:214653 25/108 (23%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 1/4 (25%)
Ig strand E 317..326 CDD:409358 1/8 (13%)
Ig strand F 336..341 CDD:409358 3/4 (75%)
cadm3XP_002937798.1 IgV_1_Necl-1 27..121 CDD:143290 29/103 (28%)
Ig strand A 27..30 CDD:143290 0/2 (0%)
FR1 28..46 CDD:143290 7/26 (27%)
Ig strand A' 31..37 CDD:143290 2/14 (14%)
Ig strand B 39..47 CDD:143290 4/7 (57%)
CDR1 47..52 CDD:143290 1/4 (25%)
FR2 53..60 CDD:143290 1/6 (17%)
Ig strand C 53..59 CDD:143290 1/5 (20%)
CDR2 61..72 CDD:143290 2/10 (20%)
Ig strand C' 63..67 CDD:143290 2/3 (67%)
Ig strand C' 69..72 CDD:143290 0/2 (0%)
FR3 73..108 CDD:143290 11/35 (31%)
Ig strand D 77..84 CDD:143290 3/6 (50%)
Ig strand E 87..93 CDD:143290 0/5 (0%)
Ig strand F 100..108 CDD:143290 3/7 (43%)
CDR3 109..112 CDD:143290 1/2 (50%)
Ig strand G 112..121 CDD:143290 2/8 (25%)
FR4 114..121 CDD:143290 2/6 (33%)
Ig 122..224 CDD:472250 22/111 (20%)
Ig strand B 143..147 CDD:409353 2/3 (67%)
Ig strand C 157..161 CDD:409353 0/3 (0%)
Ig strand E 187..191 CDD:409353 0/3 (0%)
Ig strand F 201..206 CDD:409353 1/4 (25%)
Ig strand G 217..220 CDD:409353 0/2 (0%)
Ig_3 227..299 CDD:464046 23/102 (23%)
4.1m 354..372 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.