DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and cadm4

DIOPT Version :10

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_002939173.1 Gene:cadm4 / 100488420 XenbaseID:XB-GENE-992659 Length:394 Species:Xenopus tropicalis


Alignment Length:416 Identity:98/416 - (23%)
Similarity:149/416 - (35%) Gaps:102/416 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLQSTLFVILIMATKCGSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILACSVRNLGKN 68
            |.|..:..|:::||   :|:..:|..::              .|||...|..|.::|.:.....:
 Frog    12 LQQRFVLGIVLLAT---AGTVVSQEVQA--------------ENVTVVEGGTAEISCHLHQYDGS 59

  Fly    69 KVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVG 133
            .|.......|| |...|.....:.|..::.......|:.:|..:..|.|.|.||:.|.....|:.
 Frog    60 IVVIQNPVRQT-LFFNGTRALKDTRFQLVEFTQKVVKIHLSDAKLEDEGGYFCQLYTEDTHHQIA 123

  Fly   134 CIDVQVPPD--IINEESSADLAVQEGEDATLTC-KATGNPQPRVTWRREDGEMILIRKPGSRELM 195
            .:.|.||||  ::..:..|    .||.:..||| .....|...:.|.|:       ||.......
 Frog   124 TLTVIVPPDNPLVEVKEQA----VEGGEIELTCISPRTRPAATLRWYRD-------RKELKGFTS 177

  Fly   196 KVESYNG------SSLRLLRLERRQMGAYLCIASNDVPPAVSKRV--SLSVQFAPMVR-APSQLL 251
            |.|  ||      :|:|.....:.......|.||:.......|:.  .|.|||:|... .|||.|
 Frog   178 KQE--NGKTFSITNSIRFSVDRKDDRDIVTCEASHPALKGQKKQTQYELDVQFSPTANIQPSQSL 240

  Fly   252 GTPLGSDVQLECQVEASPSPVS-YWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERR 315
             ...|.::.|:|:|..:|.|.. .|.:               |....|               .|
 Frog   241 -VREGDELNLKCEVTGNPRPTEIIWTR---------------LNDSLP---------------ER 274

  Fly   316 DGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRA--EGTLRLYEIKLHPGASASNDDHLNY--IGG 376
            ...:| .:|...|.|..|.|||.|..:|..||:  :..|.:|:    |||.......:.|  |||
 Frog   275 AQIQG-DVLSFPSLSLQDNGTYSCQVSNKHGRSSDQYVLVVYD----PGAIIEAQTQVPYAVIGG 334

  Fly   377 LEEAARNAGRSNRTTWQPLLAMLMLL 402
                              :||:|:.|
 Frog   335 ------------------ILALLVFL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 20/81 (25%)
Ig strand B 56..60 CDD:409353 1/3 (33%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 1/3 (33%)
Ig strand F 118..123 CDD:409353 2/4 (50%)
Ig 141..238 CDD:472250 24/107 (22%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 0/3 (0%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 1/4 (25%)
Ig strand G 231..234 CDD:409562 1/2 (50%)
IG_like 247..355 CDD:214653 27/110 (25%)
Ig strand B 259..263 CDD:409358 1/3 (33%)
Ig strand C 272..276 CDD:409358 0/4 (0%)
Ig strand E 317..326 CDD:409358 2/8 (25%)
Ig strand F 336..341 CDD:409358 3/4 (75%)
cadm4XP_002939173.1 IgI_2_Necl-4 128..226 CDD:409468 26/110 (24%)
Ig strand A 128..131 CDD:409468 1/2 (50%)
Ig strand A' 134..138 CDD:409468 0/3 (0%)
Ig strand B 146..156 CDD:409468 3/9 (33%)
Ig strand C 159..168 CDD:409468 2/8 (25%)
Ig strand C' 169..172 CDD:409468 2/2 (100%)
Ig strand D 174..181 CDD:409468 2/8 (25%)
Ig strand E 184..194 CDD:409468 2/9 (22%)
Ig strand F 202..210 CDD:409468 2/7 (29%)
Ig strand G 218..225 CDD:409468 1/6 (17%)
Ig_3 230..301 CDD:464046 24/102 (24%)
4.1m 350..368 CDD:128590
Ig 37..127 CDD:472250 21/90 (23%)
Ig strand B 47..51 CDD:409353 1/3 (33%)
Ig strand C 60..64 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 120..123 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.