DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and adgrl1.1

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_002660669.2 Gene:adgrl1.1 / 100334775 ZFINID:ZDB-GENE-130116-2 Length:390 Species:Danio rerio


Alignment Length:235 Identity:50/235 - (21%)
Similarity:87/235 - (37%) Gaps:68/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 AVQEGEDATLTCKATGNPQPRVTWRREDGEM--------------ILIRKPGSRELMKVESYNGS 203
            ||:.||..:...:.|...||.:.   |.|:|              :.:.:|.|  :.:.|.::|:
Zfish    33 AVRLGETVSFQHRVTSRAQPGML---ESGKMNNQTLGVFVCPGTLVRVLEPSS--VREAEDHSGA 92

  Fly   204 SLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFA-----------PMVRAPSQLLGTP-LG 256
            ..:    :..|.|..|.     |.|....|..:..::|           ...:.||::.||. :.
Zfish    93 WCK----DPLQAGDRLY-----VMPWTPYRTDMLYEYASWDDYIQNRVTTTYKLPSRVDGTGFVV 148

  Fly   257 SDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSP---GPEMLLD--GPKYGI----- 311
            .|..:....|.:.:.|.|.|: .|..:|.|.:..|:....||   |.:..:|  ..::|:     
Zfish   149 YDGAVFYNKERTRNIVKYDLR-TRIKSGEAVIVNANYHDASPYHRGGKSDIDLAVDEHGLWVIYT 212

  Fly   312 TERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGT 351
            ||..:|     .|||...:|..:            |.|||
Zfish   213 TEANNG-----RLVVSQVNPYTL------------RFEGT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653
Ig 47..129 CDD:299845
Ig 140..238 CDD:299845 20/98 (20%)
IG_like 247..355 CDD:214653 29/116 (25%)
Ig 256..351 CDD:299845 23/104 (22%)
adgrl1.1XP_002660669.2 OLF 72..328 CDD:295358 40/193 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.