DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-gamma and negr1

DIOPT Version :9

Sequence 1:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:347 Identity:96/347 - (27%)
Similarity:147/347 - (42%) Gaps:68/347 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 INNVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKIS 109
            ::|:....|..|:|.|.:.. |.:|..||..|  :::...|...:.:.|:|:.......:.|:|.
 Frog    46 VDNLVVRQGETAMLRCFLEE-GASKGAWLNRS--SIIFAGGDKWSVDPRVSIATSSKQEYSLRIQ 107

  Fly   110 KLRESDRGCYMCQINT--SPMKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQP 172
            |:..||.|.|.|.:.|  ||...||. :.|.|.|.|.  :.|:|:.|.||.:.:|.|.|||.|:|
 Frog   108 KVDVSDDGPYTCSVQTEHSPRTLQVH-LTVHVSPKIY--DISSDMTVNEGTNVSLICLATGKPEP 169

  Fly   173 RVTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLS 237
            .::||.        ..|.:::.     .:|..|.:..:.|.|.|.|.|.|.|||.....|:|.::
 Frog   170 SISWRH--------ISPSAKQF-----GSGQYLDIYGITRDQAGDYECSAENDVSFPDVKKVKVT 221

  Fly   238 VQFAPMVR--APSQLLGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGP 300
            |.|||.:.  .|:   |..||....:.|:..|.|:||..|.||.:           .|.:|..| 
 Frog   222 VNFAPTILEITPT---GVSLGRTGLIRCETAAVPAPVFEWYKGEK-----------KLTNGQRG- 271

  Fly   301 EMLLDGPKYGITERRDGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRL----------- 354
                        .|...|....:|.|.:.:....|.|.||:.|.||.:..:|.|           
 Frog   272 ------------IRIQNYNTRSILTVSNVTEEHFGNYTCVAVNKLGTSNASLPLNQIIEPSTTSP 324

  Fly   355 ------YEIKLHPGASASNDDH 370
                  |.:| |...|:|:..|
 Frog   325 VTSSAKYSVK-HYARSSSDKPH 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 27/93 (29%)
Ig 47..129 CDD:299845 24/83 (29%)
Ig 140..238 CDD:299845 30/97 (31%)
IG_like 247..355 CDD:214653 28/124 (23%)
Ig 256..351 CDD:299845 23/94 (24%)
negr1XP_031755650.1 Ig 44..136 CDD:416386 26/93 (28%)
FR1 44..62 CDD:409353 4/15 (27%)
Ig strand A' 47..53 CDD:409353 1/5 (20%)
Ig strand B 55..63 CDD:409353 3/7 (43%)
CDR1 63..68 CDD:409353 1/5 (20%)
FR2 69..75 CDD:409353 3/5 (60%)
Ig strand C 69..74 CDD:409353 2/4 (50%)
CDR2 76..87 CDD:409353 2/12 (17%)
Ig strand C' 78..82 CDD:409353 0/3 (0%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
FR3 88..122 CDD:409353 10/33 (30%)
Ig strand D 91..98 CDD:409353 2/6 (33%)
Ig strand E 101..107 CDD:409353 1/5 (20%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..127 CDD:409353 1/3 (33%)
Ig strand G 127..136 CDD:409353 3/9 (33%)
FR4 129..136 CDD:409353 2/7 (29%)
Ig_3 140..208 CDD:404760 25/82 (30%)
Ig strand A' 146..151 CDD:409353 2/4 (50%)
Ig strand B 157..164 CDD:409353 2/6 (33%)
Ig strand C 170..175 CDD:409353 1/4 (25%)
Ig strand C' 177..179 CDD:409353 0/1 (0%)
Ig strand E 187..193 CDD:409353 1/5 (20%)
Ig strand F 200..207 CDD:409353 3/6 (50%)
Ig strand G 214..222 CDD:409353 2/7 (29%)
Ig_3 226..302 CDD:404760 24/102 (24%)
putative Ig strand A 226..232 CDD:409353 1/5 (20%)
Ig strand B 242..246 CDD:409353 0/3 (0%)
Ig strand C 255..259 CDD:409353 1/3 (33%)
Ig strand E 281..285 CDD:409353 1/3 (33%)
Ig strand F 295..300 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.