DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and AT1G20270

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:214 Identity:58/214 - (27%)
Similarity:90/214 - (42%) Gaps:49/214 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 EQLNIEPFVGLFHDAISPAEQKDLL-----HLTDSRLEHRKKDSSSVEAKVDTNASDHVRR---- 326
            |.|:.||...::|:.:|..|.:.|:     |:..|.:.. .:...|.:::|.|::...:||    
plant    77 EVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVD-SETGKSKDSRVRTSSGTFLRRGRDK 140

  Fly   327 ----IHQRIEDITGFDLEESEPLTVSNYGIGGQDFIHLDCEQPKEFIGYYPKEY-------RSAS 380
                |.:||.|.|....:..|.|.|.:|..|.:...|.|         |:..|:       |.|:
plant   141 IIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYD---------YFVDEFNTKNGGQRMAT 196

  Fly   381 AMFYLSDVQMGGYASFPDLGFGF-------------------KPRRGSALVWHNTDNSGNCDTRS 426
            .:.|||||:.||...||.....|                   |||.|.||::.:.......|..|
plant   197 MLMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDPTS 261

  Fly   427 LQATCPVLLGNQWVAKKWI 445
            |...|||:.||:|.:.||:
plant   262 LHGGCPVIRGNKWSSTKWM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528
P4Hc 287..445 CDD:214780 52/196 (27%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 57/212 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.