DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and AT5G18900

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 / 832008 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana


Alignment Length:259 Identity:65/259 - (25%)
Similarity:103/259 - (39%) Gaps:52/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LLPSKSYLRCRYLRDGSPFLRMAPVKLEQLNIEPFVGLFHDAISPAEQKDLLHLTDSRLEHRK-K 307
            ||.|.:.|    :...|.|:.  |.|::|::.:|...::...::..|...::.|..:.|:... .
plant    17 LLQSSTSL----ISSSSVFVN--PSKVKQVSSKPRAFVYEGFLTELECDHMVSLAKASLKRSAVA 75

  Fly   308 DSSSVEAK---VDTNASDHVRR--------IHQRIEDITGFDLEESEPLTVSNYGIGGQDFIHLD 361
            |:.|.|:|   |.|::...:.:        |..:|...|....|..|.:.|..|..|.:...|.|
plant    76 DNDSGESKFSEVRTSSGTFISKGKDPIVSGIEDKISTWTFLPKENGEDIQVLRYEHGQKYDAHFD 140

  Fly   362 CEQPKEFIGYYPKEYRSASAMFYLSDVQMGGYASFPDL---------------------GFGFKP 405
            ....|  :......:|.|:.:.|||:|..||...|||.                     |...||
plant   141 YFHDK--VNIVRGGHRMATILMYLSNVTKGGETVFPDAEIPSRRVLSENKEDLSDCAKRGIAVKP 203

  Fly   406 RRGSALVWHNTDNSGNCDTRSLQATCPVLLGNQWVAKKWI-----------SGSGQWRRKSCRK 458
            |:|.||::.|.......|..||...|||:.|.:|.|.|||           ||:.....:||.:
plant   204 RKGDALLFFNLHPDAIPDPLSLHGGCPVIEGEKWSATKWIHVDSFDRIVTPSGNCTDMNESCER 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528
P4Hc 287..445 CDD:214780 49/190 (26%)
AT5G18900NP_197391.1 PLN00052 33..298 CDD:177683 59/239 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.