DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and AT4G35820

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:252 Identity:66/252 - (26%)
Similarity:100/252 - (39%) Gaps:58/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 DNTDLAKHLK--DKLAHMFVHVD------------NCRGKNLLPSKSYLRCRYLRDGSPFLRMAP 267
            :.:||.:|:.  |:|....|.||            .|   :|.|..:.|.|..::..:. ||...
plant    24 ETSDLIQHINTFDELVGEQVSVDVKIEEKTKDMILLC---SLSPLLTTLTCSMVKVAAS-LRFPN 84

  Fly   268 VK-LEQLNIEP-------FVGLFHDAISPAEQKD-LLHLTDSRLEHRK---------KDSSSVEA 314
            .: ||.:..||       |:.||.......|:.| |:.|....:...|         ::|||..:
plant    85 ERWLEVITKEPRAFVYHNFLALFFKICKTNEECDHLISLAKPSMARSKVRNALTGLGEESSSRTS 149

  Fly   315 KVDTNASDH---VRRIHQRIEDITGFDLEESEPLTVSNYGIGGQDFIHLDCEQPKEFIGYYPKEY 376
            ......|.|   |:.|.:||.:.|....|..|.|.|.||.:|.:...|.|..|            
plant   150 SGTFIRSGHDKIVKEIEKRISEFTFIPQENGETLQVINYEVGQKFEPHFDGFQ------------ 202

  Fly   377 RSASAMFYLSDVQMGGYASFPDL-------GFGFKPRRGSALVWHNTDNSGNCDTRS 426
            |.|:.:.|||||..||...||:.       |...:|::|.||::.:....|:.|..|
plant   203 RIATVLMYLSDVDKGGETVFPEAKGIKSKKGVSVRPKKGDALLFWSMRPDGSRDPSS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528
P4Hc 287..445 CDD:214780 44/160 (28%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927 13/55 (24%)
P4Hc 115..262 CDD:214780 44/157 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.