DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and AT4G35810

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:213 Identity:56/213 - (26%)
Similarity:90/213 - (42%) Gaps:47/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 LEQLNIEPFVGLFHDAISPAEQKDLLHLTDSRLEHRK----KDSSSVEAKVDTNASDHVRR---- 326
            ||.::.||...::|:.::..|.:.|:.|....:...|    |...|::::|.|::...:.|    
plant    80 LEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTGKSIDSRVRTSSGTFLNRGHDE 144

  Fly   327 ----IHQRIEDITGFDLEESEPLTVSNYGIGGQDFIHLDCEQPKEFIGYYPKEY-------RSAS 380
                |..||.|.|....|..|.|.|.:|.:|.:...|.|         |:..|:       |.|:
plant   145 IVEEIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHD---------YFFDEFNVRKGGQRIAT 200

  Fly   381 AMFYLSDVQMGGYASFP-------DL------------GFGFKPRRGSALVWHNTDNSGNCDTRS 426
            .:.|||||..||...||       |:            |....|::..||::.:.....:.|..|
plant   201 VLMYLSDVDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPSS 265

  Fly   427 LQATCPVLLGNQWVAKKW 444
            |...|||:.||:|.:.||
plant   266 LHGGCPVIKGNKWSSTKW 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528
P4Hc 287..445 CDD:214780 51/196 (26%)
AT4G35810NP_001320148.1 PLN00052 75..289 CDD:177683 56/213 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.