DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and AT4G33910

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 / 829535 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana


Alignment Length:158 Identity:53/158 - (33%)
Similarity:73/158 - (46%) Gaps:25/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 SSSVEAKVDTNASDHVRRIHQRIEDITGFDLEESEPLTVSNYGIGGQDFIHLDCEQPKEFIGYYP 373
            |:|.|:   |.|.|.|.|   :|...|.......|...:..|.:|.:...|.|...|.|   |.|
plant   138 SASEES---TGALDFVER---KIARATMIPRSHGESFNILRYELGQKYDSHYDVFNPTE---YGP 193

  Fly   374 K-EYRSASAMFYLSDVQMGGYASFP-----DLGFGF----------KPRRGSALVWHNTDNSGNC 422
            : ..|.||.:.|||||:.||...||     ::|.|:          |||:|..|::::...:|..
plant   194 QSSQRIASFLLYLSDVEEGGETMFPFENGSNMGIGYDYKQCIGLKVKPRKGDGLLFYSVFPNGTI 258

  Fly   423 DTRSLQATCPVLLGNQWVAKKWISGSGQ 450
            |..||..:|||..|.:|||.|||....|
plant   259 DQTSLHGSCPVTKGEKWVATKWIRDQDQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528
P4Hc 287..445 CDD:214780 50/151 (33%)
AT4G33910NP_567941.1 PLN00052 66..287 CDD:177683 53/158 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.