DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and AT4G25600

DIOPT Version :10

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_194290.2 Gene:AT4G25600 / 828665 AraportID:AT4G25600 Length:291 Species:Arabidopsis thaliana


Alignment Length:258 Identity:60/258 - (23%)
Similarity:100/258 - (38%) Gaps:59/258 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 RGKNLLPSKSYLRCRYLRDGSPFLRMAPVKLEQLNIEPFVGLFHDAISPAEQKDLLHLTDSRLEH 304
            |.|.:.......:..|:. ||.|  :.|.::.||:..|.|.|:...:|..|...|:.|       
plant    32 RDKEITSKSDDTQASYVL-GSKF--VDPTRVLQLSWLPRVFLYRGFLSEEECDHLISL------- 86

  Fly   305 RKKDSS--SVEAKVDTNASDHVRRIHQRIEDITGFDLEESEPLTVSNYGIGGQDFIHLDCEQPKE 367
            ||:.:.  ||:|...|.....|..|.:::...|....|....:.|.:|          ..|:..:
plant    87 RKETTEVYSVDADGKTQLDPVVAGIEEKVSAWTFLPGENGGSIKVRSY----------TSEKSGK 141

  Fly   368 FIGYYPKEYRS-------ASAMFYLSDVQMGGYASFPDL-----------GFGFKPRRGSALVWH 414
            .:.|:.:|..|       |:.:.|||:...||...||:.           |...:|.:|:|:::.
plant   142 KLDYFGEEPSSVLHESLLATVVLYLSNTTQGGELLFPNSEMKPKNSCLEGGNILRPVKGNAILFF 206

  Fly   415 NTDNSGNCDTRSLQATCPVLLGNQWVAKKWI----------SGS--------GQWRR-KSCRK 458
            ....:.:.|.:|....|||:.|...||.|.|          ||.        |:|.: ..|:|
plant   207 TRLLNASLDGKSTHLRCPVVKGELLVATKLIYAKKQARIEESGECSDEDENCGRWAKLGECKK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..128 CDD:462433
P4Hc 287..445 CDD:214780 41/177 (23%)
AT4G25600NP_194290.2 PLN00052 55..291 CDD:177683 54/232 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.