DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and P4H2

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:219 Identity:57/219 - (26%)
Similarity:88/219 - (40%) Gaps:35/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 SPFLRMAPVKLEQLNIEPFVGLFHDAISPAEQKDLLHLTDSRLEHRK-KDSSSVEAKV-DTNASD 322
            ||...:.|.|::|::.:|...::...::..|...|:.|....|:... .|:.:.|::| |...|.
plant    28 SPSSIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRSAVADNDNGESQVSDVRTSS 92

  Fly   323 H----------VRRIHQRIEDITGFDLEESEPLTVSNYGIGGQDFIHLDCEQPKEFIGYYPKEYR 377
            .          |..|..::...|....|..|.|.|..|..|.:...|.|....|  :......:|
plant    93 GTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHDK--VNIARGGHR 155

  Fly   378 SASAMFYLSDVQMGGYASFPDL---------------------GFGFKPRRGSALVWHNTDNSGN 421
            .|:.:.|||:|..||...|||.                     |...||::|:||::.|......
plant   156 IATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFNLQQDAI 220

  Fly   422 CDTRSLQATCPVLLGNQWVAKKWI 445
            .|..||...|||:.|.:|.|.|||
plant   221 PDPFSLHGGCPVIEGEKWSATKWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528
P4Hc 287..445 CDD:214780 49/190 (26%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 51/192 (27%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.