DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:269 Identity:72/269 - (26%)
Similarity:106/269 - (39%) Gaps:72/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LKDKLAHMFVHVDNCRGKNLLPSKSYLRCRYLRDGS--------PFLRMAPVKLEQLNIEPFVGL 281
            |:|.....|..:...||:|         .|||||.|        ..||:..||.|.::..|.:.:
plant    33 LEDSYGTGFPSLRGLRGQN---------TRYLRDVSRWANDKDAELLRIGNVKPEVVSWSPRIIV 88

  Fly   282 FHDAISPAEQKDLLHLTDSRLEHRK----KDSSSVEAKVDTNAS---DHVRR-------IHQRIE 332
            .||.:||.|.:.|..:...||:...    |....|::.|.|::.   .||.|       |.:||.
plant    89 LHDFLSPEECEYLKAIARPRLQVSTVVDVKTGKGVKSDVRTSSGMFLTHVERSYPIIQAIEKRIA 153

  Fly   333 DITGFDLEESEPLTVSNYGIGGQDFIHLDCEQPKEFIGYYP-KEY------------RSASAMFY 384
            ..:....|..|.:.|..|             :|::|  |.| .:|            |.|:.:.|
plant   154 VFSQVPAENGELIQVLRY-------------EPQQF--YKPHHDYFADTFNLKRGGQRVATMLMY 203

  Fly   385 LSDVQMGGYASFPDLGFG-------------FKPRRGSALVWHNTDNSGNCDTRSLQATCPVLLG 436
            |:|...||...||..|.|             .||.:|.|:::.:....|..|.||:...|.||.|
plant   204 LTDDVEGGETYFPLAGDGDCTCGGKIMKGISVKPTKGDAVLFWSMGLDGQSDPRSIHGGCEVLSG 268

  Fly   437 NQWVAKKWI 445
            .:|.|.||:
plant   269 EKWSATKWM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528
P4Hc 287..445 CDD:214780 51/197 (26%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 55/213 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.