DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and P4H13

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:260 Identity:63/260 - (24%)
Similarity:99/260 - (38%) Gaps:68/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 SKEDNTDLAKHLKDKLAHMFVHVDNCRGKNLLPSKSYL-------RCRYLRDGSPFLRMAPVKLE 271
            |..|.||...| ...::::..|     |.:..|...||       :|..:.|      ||..||:
plant    49 SVNDETDSLDH-GSSVSNIPFH-----GLSWNPRVFYLPNFATKQQCEAVID------MAKPKLK 101

  Fly   272 QLNIEPFVGLFHDAISPAEQKDLLHLTDSRLEHRKKDSSSVEAKVDTNASDHVRRIHQRIEDITG 336
            ...:         |:...|..:......|..:|..:|.|.|.|.::           ::|...|.
plant   102 PSTL---------ALRKGETAETTQNYRSLHQHTDEDESGVLAAIE-----------EKIALATR 146

  Fly   337 FDLEESEPLTVSNYGIGGQDFIHLDCEQPKEFIGYYPKEY------RSASAMFYLSDVQMGGYAS 395
            |..:..|...:..|.:|.:...|.|        .::..||      |..:.:.:||.|:.||...
plant   147 FPKDYYESFNILRYQLGQKYDSHYD--------AFHSAEYGPLISQRVVTFLLFLSSVEEGGETM 203

  Fly   396 FP---------------DLGFGFKPRRGSALVWHNTDNSGNCDTRSLQATCPVLLGNQWVAKKWI 445
            ||               .:|...|||:|.|:.::|...:|..|..||..:|||:.|.:|||.|||
plant   204 FPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYNLFPNGTIDQTSLHGSCPVIKGEKWVATKWI 268

  Fly   446  445
            plant   269  268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528
P4Hc 287..445 CDD:214780 44/178 (25%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 53/218 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.