DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and P4HA1

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_000908.2 Gene:P4HA1 / 5033 HGNCID:8546 Length:534 Species:Homo sapiens


Alignment Length:529 Identity:148/529 - (27%)
Similarity:239/529 - (45%) Gaps:101/529 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASLLQIEDELIGYMRQYAMELQHKVNTMRTFQEEWMTRRALGPADPTSYVANPLISFPLMRRTY 65
            |..|:..|.:|:..::.|....:.|:..::.:.|:.....:....||..:|.:|:.:|.||:|..
Human    28 MTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLN 92

  Fly    66 TDVPKLLELAREEFKPGPFQKFIDYDLSSI--------SDVELETAVTGMLRFQGVYGMDESEMA 122
            |:..:|..|..::...|    ||    |::        :|.:...|...:||.|..|.:|...::
Human    93 TEWSELENLVLKDMSDG----FI----SNLTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTIS 149

  Fly   123 NGKLHGKQYNSRMSAADCLAVATHLENVDKGKLACK---------WFKVAIDQYEE----KLDPV 174
            .|.|.|.::.|.::|.||.         :.||:|..         |.:.|:.|.:|    .:|.|
Human   150 KGNLPGVKHKSFLTAEDCF---------ELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKV 205

  Fly   175 NRLLQTGRSQIYEK--LGLTLLAMHDL----PASQ------------AAFRDSIGWASKEDNTDL 221
            : :|......:|::  |...||....|    |..|            .|....:..::.:|.:|.
Human   206 S-VLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDDQSDQ 269

  Fly   222 AKHLKDKLAHMFVHVDN----------CRGKNLLPS---KSYLRCRYLRDG--SPFLRMAPVKLE 271
            ....|.|    .|.||.          |||:.:..:   :..|.||| .||  :|...:||.|.|
Human   270 KTTPKKK----GVAVDYLPERQKYEMLCRGEGIKMTPRRQKKLFCRY-HDGNRNPKFILAPAKQE 329

  Fly   272 QLNIEPFVGLFHDAISPAEQKDLLHLTDSRLE----HRKKDS--SSVEAKVDTNA------SDHV 324
            ....:|.:..|||.||.||.:.:..|...||.    |..:..  ::.:.:|..:|      :..|
Human   330 DEWDKPRIIRFHDIISDAEIEIVKDLAKPRLSRATVHDPETGKLTTAQYRVSKSAWLSGYENPVV 394

  Fly   325 RRIHQRIEDITGFDLEESEPLTVSNYGIGGQDFIHLDC---EQPKEFIGYYPKEY----RSASAM 382
            .||:.||:|:||.|:..:|.|.|:|||:|||...|.|.   ::|..|     ||.    |.|:.:
Human   395 SRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAF-----KELGTGNRIATWL 454

  Fly   383 FYLSDVQMGGYASFPDLGFGFKPRRGSALVWHNTDNSGNCDTRSLQATCPVLLGNQWVAKKWISG 447
            ||:|||..||...||::|....|::|:|:.|:|...||..|..:..|.||||:||:||:.||:..
Human   455 FYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHE 519

  Fly   448 SGQWRRKSC 456
            .||..|:.|
Human   520 RGQEFRRPC 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528 30/132 (23%)
P4Hc 287..445 CDD:214780 63/176 (36%)
P4HA1NP_000908.2 P4Ha_N 25..112 CDD:400573 21/91 (23%)
TPR 205..238 8/33 (24%)
P4Hc 345..518 CDD:214780 64/177 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.