DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and CG34041

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster


Alignment Length:325 Identity:69/325 - (21%)
Similarity:132/325 - (40%) Gaps:65/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLLQIEDELIGYMRQYAMELQHKVNTMRTFQEEWMTRRALGPADPTSYVANPLISFPLMRRTYTD 67
            ::|:|::.::.|:..|...|:.|:.|:.....:..|.......|..:..::|:.|:.|:....:|
  Fly   266 NILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFERDKLAIASSPVASYSLIHHMQSD 330

  Fly    68 VPKLLELAREEFKPGPFQKFIDYDLSSISDV--------ELETAVTGMLRFQGVYGMDESEMANG 124
            ........:|:  ||      ..:|:|:..:        ::.....|:.:....|.|...::|||
  Fly   331 WTHWQLFLQED--PG------KDELASLMSIKKYLPTKNDISEVCHGISKMLNAYLMTAQDIANG 387

  Fly   125 KLHGKQ--YNSR-----------------MSAADCLAVATH---LENVDKGKLACKWFKVAIDQY 167
            .:.|.|  |.|.                 ||..||:|::.|   :::.:|.|   :|..|||...
  Fly   388 VILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSK---EWLNVAISML 449

  Fly   168 EEKL--DPV--NRLLQTGRSQIYEKLGLTLLAMHDLPASQAAFRDSIGWASKED--NTDLAKHLK 226
            |...  ||:  :..|....:::|.|.....||:           :::.:|.|.:  |..|.:..|
  Fly   450 ESSAYWDPIVPSADLYLKLAEVYVKQQNWTLAL-----------ETVEFALKSNPRNAQLIRMQK 503

  Fly   227 DKLAHMFVHVDNCRGKNL------LPSKSYLRCRY-LRDGSPFLRMAPVKLEQLNIEPFVGLFHD 284
            ....|:.:........|:      |.....|.|.| .:..:.:..:||:|.|.|.|:|.|.|:|:
  Fly   504 RLSYHILLGPPKSPKLNIENNDYRLRKNGSLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYHE 568

  Fly   285  284
              Fly   569  568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528 24/130 (18%)
P4Hc 287..445 CDD:214780
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 24/130 (18%)
TPR repeat 452..491 CDD:276809 8/49 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461997
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.