DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and P4htm

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:403 Identity:91/403 - (22%)
Similarity:132/403 - (32%) Gaps:148/403 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LAVATHLENVDKGKLACKWFKVAIDQYEEKLDPVNRLLQTGRSQIYEKLGLTLLAMHDLPASQAA 205
            |...|.||.:..|             ||.|:..|     .||......|.|..| :.::|.    
  Rat   109 LGPLTRLEGIKVG-------------YERKVQVV-----AGRDHFIRTLSLKPL-LFEIPG---- 150

  Fly   206 FRDSIGWASKEDNTDLAKHLKDKLAHMFVHVDNCRG---KNLLPSKSY------LRCRYL----- 256
                              .|.|:...:.:|:...:|   ..:||::.|      :|...|     
  Rat   151 ------------------FLSDEECRLIIHLAQMKGLQRSQILPTEEYEEAMSAMRVSQLDLFQL 197

  Fly   257 ----RDGSPFLR-------------MAPVKLEQLNIEPFVGLFHDAISPAEQKD-LLHL-----T 298
                .||...||             |.|..::::         :.||......| :|.|     .
  Rat   198 LDQNHDGRLQLREVLAQTRLGNGRWMTPENIQEM---------YSAIKADPDGDGVLSLQEFSNM 253

  Fly   299 DSRLEHRKKDSSSVEAKVDTNASDH------------VRRIHQRIEDITGFD---LEESEPLTVS 348
            |.|..|:...|...|:......|.|            :|.|.||:..:|...   :|.||||.|.
  Rat   254 DLRDFHKYMRSHKAESSELVRNSHHTWLHQGEGAHHVMRAIRQRVLRLTRLSPEIVELSEPLQVV 318

  Fly   349 NYGIGGQDFIHLD---------CEQPK----EFIGYYPKEYRSASAMFYLSDVQMGGYASFP--- 397
            .||.||....|:|         |...|    |.:. :....|..:.:|||::|..||...||   
  Rat   319 RYGEGGHYHAHVDSGPVYPETVCSHTKLVANESVP-FETSCRYMTVLFYLNNVTGGGETVFPVAD 382

  Fly   398 --------------DL----------GFGFKPRRGSALVWHN--TDNS---GNCDTRSLQATCPV 433
                          ||          ....||::|:|:.|:|  .|..   |..|..||...|.|
  Rat   383 NRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGEVDDYSLHGGCLV 447

  Fly   434 LLGNQWVAKKWIS 446
            ..|.:|:|..||:
  Rat   448 TRGTKWIANNWIN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528
P4Hc 287..445 CDD:214780 57/223 (26%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 11/68 (16%)
P4Hc 247..459 CDD:214780 55/212 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.