DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11828 and phy-4

DIOPT Version :9

Sequence 1:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001123049.1 Gene:phy-4 / 189869 WormBaseID:WBGene00012815 Length:282 Species:Caenorhabditis elegans


Alignment Length:250 Identity:64/250 - (25%)
Similarity:100/250 - (40%) Gaps:41/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 TDLAKHLKDKLAHMFVHVDNCRGKNLLPSKSYLRCRYLRDG---------SPFLRMAPVKLEQLN 274
            ||......||:      .|.| ||.|....|       |||         ...:|    |:|.|:
 Worm    22 TDETLEFNDKI------WDKC-GKELRGDSS-------RDGRLVCYRLHKHLLIR----KVEILS 68

  Fly   275 IEPFVGLFHDAISPAEQKDLLHLTDS-RLEHRK-------KDSSSVEAKVDT----NASDHVRRI 327
            .|||:..:|:.:.....|..:...:: |||..|       .:.|.|.|...|    .......||
 Worm    69 SEPFILQYHNQVHRRLAKRAVQEAEALRLEQLKISGFTTTPEKSQVRAANGTWLIHTGRPSFARI 133

  Fly   328 HQRIE-DITGFDLEESEPLTVSNYGIGGQDFIHLDCEQPKEFIGYYP-KEYRSASAMFYLSDVQM 390
            .:.:: :|...||..:||..:.:|...|....|.|...|...:.... :..|.|:.:..|...:.
 Worm   134 FEGLQANINSLDLSTAEPWQILSYNADGYYAPHYDYLNPATNVQLVEGRGNRIATVLVILQIAKK 198

  Fly   391 GGYASFPDLGFGFKPRRGSALVWHNTDNSGNCDTRSLQATCPVLLGNQWVAKKWI 445
            ||...||.|....:|:.|..:||.||.::|..::::|.|.||:..|.:..|..|:
 Worm   199 GGTTVFPRLNLNIRPKAGDVIVWLNTLSTGESNSQTLHAACPIHEGTKIGATLWV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528
P4Hc 287..445 CDD:214780 42/171 (25%)
phy-4NP_001123049.1 P4Hc 81..254 CDD:214780 43/172 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.